diff --git a/desktop/kde/phonon/qt5-phonon-backend-gstreamer/pspec.xml b/desktop/kde/phonon/qt5-phonon-backend-gstreamer/pspec.xml index 1bf7695559..2d94794fea 100644 --- a/desktop/kde/phonon/qt5-phonon-backend-gstreamer/pspec.xml +++ b/desktop/kde/phonon/qt5-phonon-backend-gstreamer/pspec.xml @@ -15,8 +15,8 @@ http://download.kde.org/stable/phonon/phonon-backend-gstreamer/4.9.0/phonon-backend-gstreamer-4.9.0.tar.xz extra-cmake-modules - qt5-x11extras-devel - qt5-base-devel + qt5-x11extras-devel + qt5-base-devel qt5-phonon-devel gstreamer-devel gstreamer-devel @@ -30,8 +30,8 @@ qt5-phonon-backend-gstreamer - qt5-base - qt5-x11extras + qt5-base + qt5-x11extras qt5-phonon mesa glib2 @@ -47,6 +47,13 @@ + + 2019-06-24 + 4.9.0 + Rebuild + Mustafa Cinasal + muscnsl@gmail.com + 2018-12-11 4.9.0 diff --git a/desktop/kde/phonon/qt5-phonon-backend-vlc/pspec.xml b/desktop/kde/phonon/qt5-phonon-backend-vlc/pspec.xml index f25eff4b84..bd76c71fa4 100644 --- a/desktop/kde/phonon/qt5-phonon-backend-vlc/pspec.xml +++ b/desktop/kde/phonon/qt5-phonon-backend-vlc/pspec.xml @@ -14,7 +14,7 @@ phonon-backend-vlc allows Phonon (the KDE media library) to use VLC for audio and video playback. mirrors://kde/stable/phonon/phonon-backend-vlc/0.10.2/phonon-backend-vlc-0.10.2.tar.xz - qt5-base-devel + qt5-base-devel qt5-phonon-devel pulseaudio vlc-devel @@ -26,7 +26,7 @@ qt5-phonon-backend-vlc libgcc - qt5-base + qt5-base qt5-phonon vlc-libs @@ -39,6 +39,13 @@ + + 2019-06-24 + 0.10.2 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-02-03 0.10.2 diff --git a/desktop/kde/phonon/qt5-phonon/pspec.xml b/desktop/kde/phonon/qt5-phonon/pspec.xml index 3a22811fc4..4989e36782 100644 --- a/desktop/kde/phonon/qt5-phonon/pspec.xml +++ b/desktop/kde/phonon/qt5-phonon/pspec.xml @@ -15,9 +15,9 @@ https://download.kde.org/stable/phonon/4.10.2/phonon-4.10.2.tar.xz extra-cmake-modules - qt5-declarative-devel - qt5-base-devel - qt5-designer-devel + qt5-declarative-devel + qt5-base-devel + qt5-designer-devel alsa-lib-devel gst-plugins-base-devel @@ -34,8 +34,8 @@ qt5-phonon libgcc - qt5-base - qt5-designer + qt5-base + qt5-designer pulseaudio-libs @@ -52,8 +52,8 @@ Development files for phonon-qt5 qt5-phonon - qt5-base-devel - qt5-designer-devel + qt5-base-devel + qt5-designer-devel pulseaudio-libs-devel @@ -64,6 +64,13 @@ + + 2019-06-24 + 4.10.2 + Rebuild. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 4.10.2 diff --git a/desktop/toolkit/qscintilla2/pspec.xml b/desktop/toolkit/qscintilla2/pspec.xml index 9d1f799ffb..6930e64bb3 100644 --- a/desktop/toolkit/qscintilla2/pspec.xml +++ b/desktop/toolkit/qscintilla2/pspec.xml @@ -15,17 +15,17 @@ QScintilla2 is a port to Qt4 of Neil Hodgson's Scintilla C++ editor class. https://sourceforge.net/projects/pyqt/files/QScintilla2/QScintilla-2.10.8/QScintilla_gpl-2.10.8.tar.gz - python-qt5-devel - python3-qt5-devel + python-qt5-devel + python3-qt5-devel python-devel python3-devel python3-sip python-sip - qt5-base-devel - qt5-designer-devel + qt5-base-devel + qt5-designer-devel chrpath - qt5-script-devel - qt5-xmlpatterns-devel + qt5-script-devel + qt5-xmlpatterns-devel mesa-devel qscintilla2-python-common @@ -38,7 +38,7 @@ qscintilla2 - qt5-base + qt5-base libgcc @@ -111,6 +111,13 @@ + + 2019-07-08 + 2.10.8 + Rebuild qt5. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 2.10.8 diff --git a/desktop/toolkit/qt5/polkit-qt/pspec.xml b/desktop/toolkit/qt5/polkit-qt/pspec.xml index 917a513af9..b7ce0a8f8f 100755 --- a/desktop/toolkit/qt5/polkit-qt/pspec.xml +++ b/desktop/toolkit/qt5/polkit-qt/pspec.xml @@ -12,7 +12,7 @@ A library that allows developers to access PolicyKit API with a nice Qt-style API http://download.kde.org/stable/apps/KDE4.x/admin/polkit-qt-1-0.112.0.tar.bz2 - qt5-base-devel + qt5-base-devel glib2-devel polkit-devel mesa-devel @@ -25,7 +25,7 @@ polkit-qt - qt5-base + qt5-base glib2 polkit libgcc @@ -40,7 +40,7 @@ polkit-qt-devel polkit-qt - qt5-base-devel + qt5-base-devel glib2-devel polkit-devel @@ -51,6 +51,13 @@ + + 2019-06-20 + 0.112 + Rebuild for qt5.13.0 + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 0.112 diff --git a/desktop/toolkit/qt5/qt5-3d/pspec.xml b/desktop/toolkit/qt5/qt5-3d/pspec.xml index 2835d396be..69f83e27ff 100755 --- a/desktop/toolkit/qt5/qt5-3d/pspec.xml +++ b/desktop/toolkit/qt5/qt5-3d/pspec.xml @@ -15,10 +15,10 @@ desktop C++ and QML APIs for easy inclusion of 3D graphics C++ and QML APIs for easy inclusion of 3D graphics - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qt3d-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qt3d-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel assimp-devel zlib-devel @@ -27,8 +27,8 @@ qt5-3d C++ and QML APIs for easy inclusion of 3D graphics - qt5-base - qt5-declarative + qt5-base + qt5-declarative libgcc assimp @@ -44,8 +44,8 @@ qt5-3d-devel Development files for qt5-3d - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel qt5-3d @@ -56,6 +56,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-accountsservice/pspec.xml b/desktop/toolkit/qt5/qt5-accountsservice/pspec.xml index 174816a894..4ffcca0ad6 100755 --- a/desktop/toolkit/qt5/qt5-accountsservice/pspec.xml +++ b/desktop/toolkit/qt5/qt5-accountsservice/pspec.xml @@ -13,8 +13,8 @@ LGPLv2.1-linking-exception https://github.com/hawaii-desktop/qtaccountsservice/archive/v0.6.0.tar.gz - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel extra-cmake-modules @@ -23,8 +23,8 @@ qt5-accountsservice libgcc - qt5-base - qt5-declarative + qt5-base + qt5-declarative /usr/lib @@ -42,12 +42,19 @@ /usr/include - qt5-base + qt5-base qt5-accountsservice + + 2019-06-20 + 0.6.0 + Rebuild + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 0.6.0 diff --git a/desktop/toolkit/qt5/qt5-base/files/qtbase-qxcbwindow.patch b/desktop/toolkit/qt5/qt5-base/files/qtbase-qxcbwindow.patch new file mode 100644 index 0000000000..90301faaf8 --- /dev/null +++ b/desktop/toolkit/qt5/qt5-base/files/qtbase-qxcbwindow.patch @@ -0,0 +1,95 @@ +From 0c1831178540462da31fd7a4b6d2e446bc84498b Mon Sep 17 00:00:00 2001 +From: Erik Kurzinger +Date: Thu, 13 Jun 2019 08:15:50 -0700 +Subject: Track swap interval in QXcbWindow + +As per GLX_EXT_swap_control, the GLX swap interval is specified on a +per-drawable basis. However, QGLXContext only tracks it per-context +using the m_swapInterval member. If a new drawable is made current to a +context, it is still necessary to call glXSwapIntervalEXT to change the +swap interval, even if it has been previously called for the same +context with a different drawable. However, currently, +QGLXContext::makeCurrent doesn't do this if its m_swapInterval field +matches the new swap interval. This change removes m_swapInterval from +QGLXContext, instead tracking it in QXcbWindow. This still avoids +unnecessary calls to glXSwapIntervalEXT, while ensuring the swap +interval is always set for new window drawables. + +Change-Id: Idc34101476c6af618059f6f3d8925dee743994a3 +Reviewed-by: Giuseppe D'Angelo +Reviewed-by: Laszlo Agocs +--- + .../platforms/xcb/gl_integrations/xcb_glx/qglxintegration.cpp | 6 +++--- + src/plugins/platforms/xcb/gl_integrations/xcb_glx/qglxintegration.h | 1 - + src/plugins/platforms/xcb/qxcbwindow.h | 4 ++++ + 3 files changed, 7 insertions(+), 4 deletions(-) + +diff --git a/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qglxintegration.cpp b/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qglxintegration.cpp +index 4adf662152..f26f698e76 100644 +--- a/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qglxintegration.cpp ++++ b/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qglxintegration.cpp +@@ -204,7 +204,6 @@ QGLXContext::QGLXContext(QXcbScreen *screen, const QSurfaceFormat &format, QPlat + , m_shareContext(0) + , m_format(format) + , m_isPBufferCurrent(false) +- , m_swapInterval(-1) + , m_ownsContext(nativeHandle.isNull()) + , m_getGraphicsResetStatus(0) + , m_lost(false) +@@ -567,9 +566,9 @@ bool QGLXContext::makeCurrent(QPlatformSurface *surface) + + if (success && surfaceClass == QSurface::Window) { + int interval = surface->format().swapInterval(); ++ QXcbWindow *window = static_cast(surface); + QXcbScreen *screen = screenForPlatformSurface(surface); +- if (interval >= 0 && m_swapInterval != interval && screen) { +- m_swapInterval = interval; ++ if (interval >= 0 && interval != window->swapInterval() && screen) { + typedef void (*qt_glXSwapIntervalEXT)(Display *, GLXDrawable, int); + typedef void (*qt_glXSwapIntervalMESA)(unsigned int); + static qt_glXSwapIntervalEXT glXSwapIntervalEXT = 0; +@@ -588,6 +587,7 @@ bool QGLXContext::makeCurrent(QPlatformSurface *surface) + glXSwapIntervalEXT(m_display, glxDrawable, interval); + else if (glXSwapIntervalMESA) + glXSwapIntervalMESA(interval); ++ window->setSwapInterval(interval); + } + } + +diff --git a/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qglxintegration.h b/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qglxintegration.h +index be9d3f5dcb..2a88fd6e59 100644 +--- a/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qglxintegration.h ++++ b/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qglxintegration.h +@@ -87,7 +87,6 @@ private: + GLXContext m_shareContext; + QSurfaceFormat m_format; + bool m_isPBufferCurrent; +- int m_swapInterval; + bool m_ownsContext; + GLenum (APIENTRY * m_getGraphicsResetStatus)(); + bool m_lost; +diff --git a/src/plugins/platforms/xcb/qxcbwindow.h b/src/plugins/platforms/xcb/qxcbwindow.h +index f98cd8a74d..8258cc2dfa 100644 +--- a/src/plugins/platforms/xcb/qxcbwindow.h ++++ b/src/plugins/platforms/xcb/qxcbwindow.h +@@ -184,6 +184,9 @@ public: + static void setWindowTitle(const QXcbConnection *conn, xcb_window_t window, const QString &title); + static QString windowTitle(const QXcbConnection *conn, xcb_window_t window); + ++ int swapInterval() const { return m_swapInterval; } ++ void setSwapInterval(int swapInterval) { m_swapInterval = swapInterval; } ++ + public Q_SLOTS: + void updateSyncRequestCounter(); + +@@ -276,6 +279,7 @@ protected: + SyncState m_syncState = NoSyncNeeded; + + QXcbSyncWindowRequest *m_pendingSyncRequest = nullptr; ++ int m_swapInterval = -1; + }; + + class QXcbForeignWindow : public QXcbWindow +-- +cgit v1.2.1 + diff --git a/desktop/toolkit/qt5/qt5-base/files/qtbase-zlib-compression.patch b/desktop/toolkit/qt5/qt5-base/files/qtbase-zlib-compression.patch new file mode 100644 index 0000000000..a2ef4d2861 --- /dev/null +++ b/desktop/toolkit/qt5/qt5-base/files/qtbase-zlib-compression.patch @@ -0,0 +1,39 @@ +From cbdc9a7786278c31fdb6eb465f32d0374349c1ef Mon Sep 17 00:00:00 2001 +From: Thiago Macieira +Date: Thu, 20 Jun 2019 09:36:46 -0700 +Subject: RCC: Change the default compression to Zlib + +Codebases using QResource::isCompressed() and assuming it is Zlib break +if zstd is enabled. So change the default back to Zlib until Qt 6.0. + +[ChangeLog][Important Behavior Changes] RCC's default compression +algorithm was changed back to Zlib, as it was in all previous releases +until 5.13.0. The default will remain Zlib for all Qt 5.x releases but +will change in Qt 6.0. To activate Zstd compression for your resources, +either pass the --compress-algo=zstd option to the rcc tool or add the +XML attribute compression-algorithm="zstd" to the tags in the +.qrc file. + +Task-number: QTBUG-76521 +Change-Id: Ief874765cd7b43798de3fffd15a9f56fd9ad1ad4 +Reviewed-by: Simon Hausmann +--- + src/tools/rcc/rcc.cpp | 2 +- + 1 file changed, 1 insertion(+), 1 deletion(-) + +diff --git a/src/tools/rcc/rcc.cpp b/src/tools/rcc/rcc.cpp +index 862e574f2d..011a7db810 100644 +--- a/src/tools/rcc/rcc.cpp ++++ b/src/tools/rcc/rcc.cpp +@@ -58,7 +58,7 @@ enum { + CONSTANT_COMPRESSTHRESHOLD_DEFAULT = 70 + }; + +-#if QT_CONFIG(zstd) ++#if QT_CONFIG(zstd) && QT_VERSION >= QT_VERSION_CHECK(6,0,0) + # define CONSTANT_COMPRESSALGO_DEFAULT RCCResourceLibrary::CompressionAlgorithm::Zstd + #elif !defined(QT_NO_COMPRESS) + # define CONSTANT_COMPRESSALGO_DEFAULT RCCResourceLibrary::CompressionAlgorithm::Zlib +-- +cgit v1.2.1 + diff --git a/desktop/toolkit/qt5/qt5-base/files/virtualbox-focus.patch b/desktop/toolkit/qt5/qt5-base/files/virtualbox-focus.patch new file mode 100644 index 0000000000..a216fa23ee --- /dev/null +++ b/desktop/toolkit/qt5/qt5-base/files/virtualbox-focus.patch @@ -0,0 +1,27 @@ +diff --git a/src/plugins/platforms/xcb/qxcbconnection.cpp b/src/plugins/platforms/xcb/qxcbconnection.cpp +index 06d1000993b..f98b2dfe3af 100644 +--- a/src/plugins/platforms/xcb/qxcbconnection.cpp ++++ b/src/plugins/platforms/xcb/qxcbconnection.cpp +@@ -132,7 +132,9 @@ QXcbConnection::QXcbConnection(QXcbNativeInterface *nativeInterface, bool canGra + if (!m_startupId.isNull()) + qunsetenv("DESKTOP_STARTUP_ID"); + ++ const int focusInDelay = 100; + m_focusInTimer.setSingleShot(true); ++ m_focusInTimer.setInterval(focusInDelay); + m_focusInTimer.callOnTimeout([]() { + // No FocusIn events for us, proceed with FocusOut normally. + QWindowSystemInterface::handleWindowActivated(nullptr, Qt::ActiveWindowFocusReason); +diff --git a/src/plugins/platforms/xcb/qxcbwindow.cpp b/src/plugins/platforms/xcb/qxcbwindow.cpp +index 9382488b741..610eca06a55 100644 +--- a/src/plugins/platforms/xcb/qxcbwindow.cpp ++++ b/src/plugins/platforms/xcb/qxcbwindow.cpp +@@ -848,7 +848,7 @@ void QXcbWindow::doFocusOut() + connection()->setFocusWindow(nullptr); + relayFocusToModalWindow(); + // Do not set the active window to nullptr if there is a FocusIn coming. +- connection()->focusInTimer().start(400); ++ connection()->focusInTimer().start(); + } + + struct QtMotifWmHints { diff --git a/desktop/toolkit/qt5/qt5-base/pspec.xml b/desktop/toolkit/qt5/qt5-base/pspec.xml index 43281bbca5..9226e7b7cf 100755 --- a/desktop/toolkit/qt5/qt5-base/pspec.xml +++ b/desktop/toolkit/qt5/qt5-base/pspec.xml @@ -11,7 +11,7 @@ Cross platform application and UI framework Cross platform application and UI development framework 'GPL3' 'LGPL3' 'FDL' 'custom' - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtbase-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtbase-everywhere-src-5.13.0.tar.xz @@ -78,8 +78,9 @@ mkspecs.patch - - + qtbase-qxcbwindow.patch + qtbase-zlib-compression.patch + virtualbox-focus.patch @@ -262,6 +263,13 @@ --> + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-16 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-canvas3d/pspec.xml b/desktop/toolkit/qt5/qt5-canvas3d/pspec.xml index db30f68c98..c9772a59df 100755 --- a/desktop/toolkit/qt5/qt5-canvas3d/pspec.xml +++ b/desktop/toolkit/qt5/qt5-canvas3d/pspec.xml @@ -15,18 +15,18 @@ desktop A JavaScript 3D rendering API for Qt Quick A JavaScript 3D rendering API for Qt Quick - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtcanvas3d-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.12/5.12.4/submodules/qtcanvas3d-everywhere-src-5.12.4.tar.xz - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel qt5-canvas3d A JavaScript 3D rendering API for Qt Quick - qt5-base - qt5-declarative + qt5-base + qt5-declarative libgcc @@ -35,6 +35,13 @@ + + 2019-06-20 + 5.12.4 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-charts/pspec.xml b/desktop/toolkit/qt5/qt5-charts/pspec.xml index 5ec5f42a9c..48e649b9bd 100755 --- a/desktop/toolkit/qt5/qt5-charts/pspec.xml +++ b/desktop/toolkit/qt5/qt5-charts/pspec.xml @@ -11,18 +11,18 @@ GPL3 Provides a set of easy to use chart components Provides a set of easy to use chart components - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtcharts-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtcharts-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel qt5-charts Provides a set of easy to use chart components - qt5-base - qt5-declarative + qt5-base + qt5-declarative libgcc @@ -36,7 +36,7 @@ qt5-charts-devel Development files for qt5-charts - qt5-base-devel + qt5-base-devel qt5-charts @@ -47,6 +47,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-configuration/pspec.xml b/desktop/toolkit/qt5/qt5-configuration/pspec.xml index d13f6c1316..0f5d72a385 100755 --- a/desktop/toolkit/qt5/qt5-configuration/pspec.xml +++ b/desktop/toolkit/qt5/qt5-configuration/pspec.xml @@ -15,9 +15,9 @@ glib2-devel dconf-devel - qt5-declarative-devel + qt5-declarative-devel cmake - qt5-base-devel + qt5-base-devel @@ -25,10 +25,10 @@ qt5-configuration libgcc - qt5-declarative + qt5-declarative glib2 dconf - qt5-base + qt5-base /usr/lib @@ -48,11 +48,18 @@ qt5-configuration - qt5-base-devel + qt5-base-devel + + 2019-06-20 + 0.3.1 + Rebuild + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 0.3.1 diff --git a/desktop/toolkit/qt5/qt5-connectivity/pspec.xml b/desktop/toolkit/qt5/qt5-connectivity/pspec.xml index c675fa5a7b..1b177d212a 100755 --- a/desktop/toolkit/qt5/qt5-connectivity/pspec.xml +++ b/desktop/toolkit/qt5/qt5-connectivity/pspec.xml @@ -11,12 +11,12 @@ Provides access to Bluetooth hardware Provides access to Bluetooth hardware LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtconnectivity-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtconnectivity-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-declarative-devel + qt5-assistant-devel + qt5-sql-sqlite bluez-libs-devel @@ -24,8 +24,8 @@ qt5-connectivity - qt5-base - qt5-declarative + qt5-base + qt5-declarative bluez-libs libgcc @@ -46,7 +46,7 @@ qt5-connectivity - qt5-base-devel + qt5-base-devel @@ -61,6 +61,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-datavis3d/pspec.xml b/desktop/toolkit/qt5/qt5-datavis3d/pspec.xml index ed4a971a9c..d10840dd36 100755 --- a/desktop/toolkit/qt5/qt5-datavis3d/pspec.xml +++ b/desktop/toolkit/qt5/qt5-datavis3d/pspec.xml @@ -12,18 +12,18 @@ desktop Provides a set of easy to use chart components Qt Data Visualization module - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtdatavis3d-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtdatavis3d-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel qt5-datavis3d Qt Data Visualization module - qt5-base - qt5-declarative + qt5-base + qt5-declarative libgcc @@ -37,8 +37,8 @@ qt5-datavis3d-devel Development files for qt5-datavis3d - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel qt5-datavis3d @@ -49,6 +49,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-declarative/pspec.xml b/desktop/toolkit/qt5/qt5-declarative/pspec.xml index 8a8259b2ee..c1ef88bf38 100755 --- a/desktop/toolkit/qt5/qt5-declarative/pspec.xml +++ b/desktop/toolkit/qt5/qt5-declarative/pspec.xml @@ -11,13 +11,14 @@ Classes for QML and JavaScript languages Classes for QML and JavaScript languages LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtdeclarative-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtdeclarative-everywhere-src-5.13.0.tar.xz - qt5-base-devel + qt5-base-devel libxkbcommon-devel mesa-devel - qt5-assistant-devel - qt5-sql-sqlite + + qt5-assistant-devel + qt5-sql-sqlite @@ -25,8 +26,9 @@ qt5-declarative libgcc - qt5-base + qt5-base mesa + /usr/lib @@ -46,7 +48,7 @@ /usr/include/qt5 - qt5-base-devel + qt5-base-devel qt5-declarative @@ -54,7 +56,7 @@ qt5-declarative-docs - qt5-base + qt5-base /usr/share/doc/qt5 @@ -62,6 +64,13 @@ + + 2019-06-21 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-06-20 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-doc/pspec.xml b/desktop/toolkit/qt5/qt5-doc/pspec.xml index ee591d40b0..ac679a4c56 100755 --- a/desktop/toolkit/qt5/qt5-doc/pspec.xml +++ b/desktop/toolkit/qt5/qt5-doc/pspec.xml @@ -12,40 +12,40 @@ A cross-platform application and UI framework (Documentation) A cross-platform application and UI framework (Documentation) LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtdoc-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtdoc-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-sql-sqlite - qt5-assistant - qt5-multimedia-docs - qt5-quickcontrols-docs - qt5-quickcontrols2-docs - qt5-x11extras-docs - qt5-webchannel-docs + qt5-base-devel + qt5-sql-sqlite + qt5-assistant + qt5-multimedia-docs + qt5-quickcontrols-docs + qt5-quickcontrols2-docs + qt5-x11extras-docs + qt5-webchannel-docs qt5-webkit-docs - qt5-xmlpatterns-docs - qt5-svg-docs - qt5-script-docs - qt5-sensors-docs - qt5-translations - qt5-graphicaleffects-docs - qt5-imageformats-docs - qt5-websockets-docs - qt5-serialport-docs - qt5-location-docs - qt5-connectivity-docs + qt5-xmlpatterns-docs + qt5-svg-docs + qt5-script-docs + qt5-sensors-docs + qt5-translations + qt5-graphicaleffects-docs + qt5-imageformats-docs + qt5-websockets-docs + qt5-serialport-docs + qt5-location-docs + qt5-connectivity-docs qt5-doc - qt5-base - qt5-script - qt5-svg - qt5-xmlpatterns - qt5-assistant - qt5-declarative + qt5-base + qt5-script + qt5-svg + qt5-xmlpatterns + qt5-assistant + qt5-declarative /usr/share/licenses @@ -54,6 +54,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-enginio/pspec.xml b/desktop/toolkit/qt5/qt5-enginio/pspec.xml index 99d1da6065..188748216d 100755 --- a/desktop/toolkit/qt5/qt5-enginio/pspec.xml +++ b/desktop/toolkit/qt5/qt5-enginio/pspec.xml @@ -11,13 +11,13 @@ A Backend-as-a-Service solution to ease the backend development for connected and data-driven application A Backend-as-a-Service solution to ease the backend development for connected and data-driven application LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.6/5.6.3/submodules/qtenginio-opensource-src-1.6.3.tar.xz + http://ftp.vim.org/languages/qt/archive/qt/5.6/5.6.3/submodules/qtenginio-opensource-src-1.6.3.tar.xz libgcc - qt5-base-devel - qt5-declarative-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-declarative-devel + qt5-assistant-devel + qt5-sql-sqlite @@ -25,8 +25,8 @@ qt5-enginio libgcc - qt5-base - qt5-declarative + qt5-base + qt5-declarative /usr/lib @@ -45,7 +45,7 @@ /usr/include/qt5/ - qt5-base-devel + qt5-base-devel qt5-enginio @@ -61,6 +61,13 @@ + + 2019-06-20 + 5.6.3 + Rebuild for qt5.13.0 + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.6.3 diff --git a/desktop/toolkit/qt5/qt5-gamepad/pspec.xml b/desktop/toolkit/qt5/qt5-gamepad/pspec.xml index f79fdf094c..7ae42f7886 100755 --- a/desktop/toolkit/qt5/qt5-gamepad/pspec.xml +++ b/desktop/toolkit/qt5/qt5-gamepad/pspec.xml @@ -15,10 +15,10 @@ desktop A JavaScript 3D rendering API for Qt Quick Adds support for getting events from gamepad devices - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtgamepad-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtgamepad-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel libsdl2-devel eudev-devel @@ -27,8 +27,8 @@ qt5-gamepad Adds support for getting events from gamepad devices - qt5-base - qt5-declarative + qt5-base + qt5-declarative libsdl2 eudev libgcc @@ -45,7 +45,7 @@ qt5-gamepad-devel Development files for qt5-gamepad - qt5-base-devel + qt5-base-devel qt5-gamepad @@ -56,6 +56,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-graphicaleffects/pspec.xml b/desktop/toolkit/qt5/qt5-graphicaleffects/pspec.xml index 5fbb951ca3..166696873b 100755 --- a/desktop/toolkit/qt5/qt5-graphicaleffects/pspec.xml +++ b/desktop/toolkit/qt5/qt5-graphicaleffects/pspec.xml @@ -11,20 +11,20 @@ Graphical effects for use with Qt Quick 2 Graphical effects for use with Qt Quick 2 LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtgraphicaleffects-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtgraphicaleffects-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-declarative-devel + qt5-assistant-devel + qt5-sql-sqlite qt5-graphicaleffects - qt5-base - qt5-declarative + qt5-base + qt5-declarative libgcc @@ -38,7 +38,7 @@ qt5-graphicaleffects-docs - qt5-base + qt5-base /usr/share/doc/qt5 @@ -46,6 +46,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-gstreamer/pspec.xml b/desktop/toolkit/qt5/qt5-gstreamer/pspec.xml index 46c0050d87..f54a76900b 100755 --- a/desktop/toolkit/qt5/qt5-gstreamer/pspec.xml +++ b/desktop/toolkit/qt5/qt5-gstreamer/pspec.xml @@ -14,9 +14,9 @@ QtGStreamer is a set of libraries providing C++ bindings for GStreamer with a Qt-style API, plus some helper classes and elements for integrating GStreamer better in Qt applications.The goal of this module is to allow easy use of GStreamer for applications targetting MeeGo Mobile or the KDE desktop. http://gstreamer.freedesktop.org/src/qt-gstreamer/qt-gstreamer-1.2.0.tar.xz - qt5-base-devel - qt5-declarative-devel - qt5-quickcontrols2-devel + qt5-base-devel + qt5-declarative-devel + qt5-quickcontrols2-devel glib2-devel gobject-introspection-devel cmake @@ -34,8 +34,8 @@ qt5-gstreamer - qt5-base - qt5-declarative + qt5-base + qt5-declarative gstreamer gst-plugins-base @@ -56,9 +56,9 @@ qt5-gstreamer glib2-devel - qt5-base-devel + qt5-base-devel gstreamer-devel - qt5-declarative-devel + qt5-declarative-devel gst-plugins-base-devel @@ -69,6 +69,13 @@ + + 2019-06-20 + 1.2.0 + Rebuild. + Pisi Linux Community + admin@pisilinux.org + 2019-03-14 1.2.0 diff --git a/desktop/toolkit/qt5/qt5-imageformats/pspec.xml b/desktop/toolkit/qt5/qt5-imageformats/pspec.xml index 551057f058..204023359c 100755 --- a/desktop/toolkit/qt5/qt5-imageformats/pspec.xml +++ b/desktop/toolkit/qt5/qt5-imageformats/pspec.xml @@ -11,11 +11,11 @@ Plugins for additional image formats: TIFF, MNG, TGA, WBMP Plugins for additional image formats: TIFF, MNG, TGA, WBMP LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtimageformats-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtimageformats-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-assistant-devel + qt5-sql-sqlite jasper-devel libmng-devel libjpeg-turbo-devel @@ -28,7 +28,7 @@ qt5-imageformats - qt5-base + qt5-base libgcc libmng tiff @@ -45,7 +45,7 @@ qt5-imageformats-docs - qt5-base + qt5-base /usr/share/doc @@ -53,6 +53,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-keychain/pspec.xml b/desktop/toolkit/qt5/qt5-keychain/pspec.xml index 84bacf2be3..22a8eb3dad 100755 --- a/desktop/toolkit/qt5/qt5-keychain/pspec.xml +++ b/desktop/toolkit/qt5/qt5-keychain/pspec.xml @@ -14,10 +14,10 @@ https://github.com/frankosterfeld/qtkeychain/archive/v0.9.1.tar.gz extra-cmake-modules - qt5-assistant-devel - qt5-base-devel - qt5-designer-devel - qt5-linguist + qt5-assistant-devel + qt5-base-devel + qt5-designer-devel + qt5-linguist @@ -25,7 +25,7 @@ Provides support for secure credentials storage libgcc - qt5-base + qt5-base /usr/lib @@ -46,6 +46,13 @@ + + 2019-06-20 + 0.9.1 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 0.9.1 diff --git a/desktop/toolkit/qt5/qt5-location/pspec.xml b/desktop/toolkit/qt5/qt5-location/pspec.xml index 424db7313d..94be80c3dc 100755 --- a/desktop/toolkit/qt5/qt5-location/pspec.xml +++ b/desktop/toolkit/qt5/qt5-location/pspec.xml @@ -11,7 +11,7 @@ Provides access to position, satellite and area monitoring classes Provides access to position, satellite and area monitoring classes LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtlocation-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtlocation-everywhere-src-5.13.0.tar.xz geoclue-devel glib2-devel @@ -20,17 +20,17 @@ gypsy-devel gconf-devel zlib-devel - qt5-base-devel - qt5-assistant-devel - qt5-declarative-devel - qt5-sql-sqlite + qt5-base-devel + qt5-assistant-devel + qt5-declarative-devel + qt5-sql-sqlite qt5-location - qt5-base + qt5-base glib2 icu4c gconf @@ -38,7 +38,7 @@ gypsy libgcc geoclue - qt5-declarative + qt5-declarative /usr/lib @@ -55,15 +55,15 @@ qt5-location - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel qt5-location-docs - qt5-base + qt5-base /usr/share/doc @@ -71,6 +71,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-multimedia/pspec.xml b/desktop/toolkit/qt5/qt5-multimedia/pspec.xml index fd07e8804f..cad7350cfb 100755 --- a/desktop/toolkit/qt5/qt5-multimedia/pspec.xml +++ b/desktop/toolkit/qt5/qt5-multimedia/pspec.xml @@ -11,12 +11,12 @@ Classes for audio, video, radio and camera functionality Classes for audio, video, radio and camera functionality LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtmultimedia-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtmultimedia-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-declarative-devel + qt5-assistant-devel + qt5-sql-sqlite pulseaudio-libs-devel openal-devel mesa-devel @@ -40,10 +40,10 @@ mesa openal alsa-lib - qt5-base + qt5-base gstreamer pulseaudio-libs - qt5-declarative + qt5-declarative gst-plugins-base glib2 gst-plugins-bad @@ -58,8 +58,8 @@ qt5-multimedia - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel @@ -69,11 +69,18 @@ /usr/share/doc - qt5-base + qt5-base + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-networkauth/pspec.xml b/desktop/toolkit/qt5/qt5-networkauth/pspec.xml index 2edc5c7d56..f6043003b9 100644 --- a/desktop/toolkit/qt5/qt5-networkauth/pspec.xml +++ b/desktop/toolkit/qt5/qt5-networkauth/pspec.xml @@ -12,16 +12,16 @@ app:gui Network authentication module Ağ kimlik doğrulama modülü - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtnetworkauth-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtnetworkauth-everywhere-src-5.13.0.tar.xz - qt5-base-devel + qt5-base-devel qt5-networkauth - qt5-base + qt5-base /usr/lib @@ -34,7 +34,7 @@ Development files for qt5-networkauth qt5-networkauth - qt5-base-devel + qt5-base-devel /usr/include @@ -44,6 +44,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-quickcontrols/pspec.xml b/desktop/toolkit/qt5/qt5-quickcontrols/pspec.xml index 8fa5f2e7d8..fceb65d179 100755 --- a/desktop/toolkit/qt5/qt5-quickcontrols/pspec.xml +++ b/desktop/toolkit/qt5/qt5-quickcontrols/pspec.xml @@ -11,12 +11,12 @@ Reusable Qt Quick based UI controls to create classic desktop-style user interfaces Reusable Qt Quick based UI controls to create classic desktop-style user interfaces LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtquickcontrols-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtquickcontrols-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-declarative-devel + qt5-assistant-devel + qt5-sql-sqlite mesa-devel @@ -25,8 +25,8 @@ qt5-quickcontrols libgcc - qt5-base - qt5-declarative + qt5-base + qt5-declarative /usr/lib @@ -38,7 +38,7 @@ qt5-quickcontrols-docs - qt5-base + qt5-base /usr/share/doc @@ -46,6 +46,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-quickcontrols2/pspec.xml b/desktop/toolkit/qt5/qt5-quickcontrols2/pspec.xml index 8391f71e25..f12e322a47 100755 --- a/desktop/toolkit/qt5/qt5-quickcontrols2/pspec.xml +++ b/desktop/toolkit/qt5/qt5-quickcontrols2/pspec.xml @@ -11,14 +11,14 @@ Next generation user interface controls based on Qt Quick Next generation user interface controls based on Qt Quick LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtquickcontrols2-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtquickcontrols2-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel - qt5-xmlpatterns-devel - qt5-graphicaleffects - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-declarative-devel + qt5-xmlpatterns-devel + qt5-graphicaleffects + qt5-assistant-devel + qt5-sql-sqlite @@ -26,8 +26,8 @@ qt5-quickcontrols2 libgcc - qt5-base - qt5-declarative + qt5-base + qt5-declarative /usr/lib @@ -40,7 +40,7 @@ qt5-quickcontrols2-devel qt5-quickcontrols2 - qt5-base-devel + qt5-base-devel /usr/include @@ -51,7 +51,7 @@ qt5-quickcontrols2-docs - qt5-base + qt5-base /usr/share/doc @@ -59,6 +59,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-script/pspec.xml b/desktop/toolkit/qt5/qt5-script/pspec.xml index 2b0dad9130..ae8f01e1b6 100755 --- a/desktop/toolkit/qt5/qt5-script/pspec.xml +++ b/desktop/toolkit/qt5/qt5-script/pspec.xml @@ -11,11 +11,11 @@ Classes for making Qt applications scriptable. Provided for Qt 5.x compatibility Classes for making Qt applications scriptable. Provided for Qt 5.x compatibility LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtscript-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtscript-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-assistant-devel + qt5-sql-sqlite mesa-devel libgcc @@ -24,7 +24,7 @@ qt5-script - qt5-base + qt5-base libgcc @@ -37,7 +37,7 @@ qt5-script-devel - qt5-base-devel + qt5-base-devel qt5-script @@ -49,7 +49,7 @@ qt5-script-docs - qt5-base + qt5-base /usr/share/doc/qt5 @@ -57,6 +57,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-scxml/pspec.xml b/desktop/toolkit/qt5/qt5-scxml/pspec.xml index c671f86f8e..08d2c91526 100755 --- a/desktop/toolkit/qt5/qt5-scxml/pspec.xml +++ b/desktop/toolkit/qt5/qt5-scxml/pspec.xml @@ -14,18 +14,18 @@ LGPL3 Provides a set of easy to use chart components Provides a set of easy to use chart components - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtscxml-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtscxml-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel qt5-scxml Provides a set of easy to use chart components - qt5-base - qt5-declarative + qt5-base + qt5-declarative libgcc @@ -40,8 +40,8 @@ qt5-scxml-devel Development files for qt5-scxml - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel qt5-scxml @@ -52,6 +52,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-sensors/pspec.xml b/desktop/toolkit/qt5/qt5-sensors/pspec.xml index 3cfff08c95..dad792289e 100755 --- a/desktop/toolkit/qt5/qt5-sensors/pspec.xml +++ b/desktop/toolkit/qt5/qt5-sensors/pspec.xml @@ -11,12 +11,12 @@ Provides access to sensor hardware and motion gesture recognition Provides access to sensor hardware and motion gesture recognition LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtsensors-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtsensors-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-declarative-devel + qt5-assistant-devel + qt5-sql-sqlite @@ -24,8 +24,8 @@ qt5-sensors libgcc - qt5-base - qt5-declarative + qt5-base + qt5-declarative /usr/lib @@ -38,7 +38,7 @@ qt5-sensors-devel qt5-sensors - qt5-base-devel + qt5-base-devel /usr/lib/pkgconfig @@ -49,7 +49,7 @@ qt5-sensors-docs - qt5-base + qt5-base /usr/share/doc/qt5 @@ -58,6 +58,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-serialbus/pspec.xml b/desktop/toolkit/qt5/qt5-serialbus/pspec.xml index a17eea6245..2d1082cb5f 100755 --- a/desktop/toolkit/qt5/qt5-serialbus/pspec.xml +++ b/desktop/toolkit/qt5/qt5-serialbus/pspec.xml @@ -14,18 +14,18 @@ LGPL3 Qt module for general purpose serial bus access Qt module for general purpose serial bus access - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtserialbus-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtserialbus-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-serialport-devel + qt5-base-devel + qt5-serialport-devel qt5-serialbus Qt module for general purpose serial bus access - qt5-base - qt5-serialport + qt5-base + qt5-serialport libgcc @@ -40,7 +40,7 @@ qt5-serialbus-devel Development files for qt5-serialbus - qt5-base-devel + qt5-base-devel qt5-serialbus @@ -51,6 +51,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-serialport/pspec.xml b/desktop/toolkit/qt5/qt5-serialport/pspec.xml index d314a789c0..c42a0b4953 100755 --- a/desktop/toolkit/qt5/qt5-serialport/pspec.xml +++ b/desktop/toolkit/qt5/qt5-serialport/pspec.xml @@ -11,11 +11,11 @@ Provides access to hardware and virtual serial ports Provides access to hardware and virtual serial ports LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtserialport-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtserialport-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-assistant-devel + qt5-sql-sqlite eudev-devel @@ -23,7 +23,7 @@ qt5-serialport - qt5-base + qt5-base eudev libgcc @@ -37,7 +37,7 @@ qt5-serialport-devel - qt5-base-devel + qt5-base-devel qt5-serialport @@ -49,7 +49,7 @@ qt5-serialport-docs - qt5-base + qt5-base /usr/share/doc/qt5 @@ -57,6 +57,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-speech/pspec.xml b/desktop/toolkit/qt5/qt5-speech/pspec.xml index 1e290333be..a4c44c60fc 100755 --- a/desktop/toolkit/qt5/qt5-speech/pspec.xml +++ b/desktop/toolkit/qt5/qt5-speech/pspec.xml @@ -14,10 +14,10 @@ LGPL3 Qt module to make text to speech and speech recognition easy Qt module to make text to speech and speech recognition easy - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtspeech-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtspeech-everywhere-src-5.13.0.tar.xz flite-devel - qt5-base-devel + qt5-base-devel speech-dispatcher-devel @@ -26,7 +26,7 @@ Qt module to make text to speech and speech recognition easy flite - qt5-base + qt5-base libgcc speech-dispatcher @@ -51,6 +51,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-svg/pspec.xml b/desktop/toolkit/qt5/qt5-svg/pspec.xml index cc9b3f23d0..d53ac41ea6 100755 --- a/desktop/toolkit/qt5/qt5-svg/pspec.xml +++ b/desktop/toolkit/qt5/qt5-svg/pspec.xml @@ -9,12 +9,12 @@ LGPLv2.1-linking-exception Classes for displaying the contents of SVG files Classes for displaying the contents of SVG files - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtsvg-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtsvg-everywhere-src-5.13.0.tar.xz mesa-devel - qt5-base-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-assistant-devel + qt5-sql-sqlite zlib-devel @@ -22,7 +22,7 @@ qt5-svg libgcc - qt5-base + qt5-base zlib @@ -36,7 +36,7 @@ qt5-svg-devel Development files for qt5-svg - qt5-base-devel + qt5-base-devel qt5-svg @@ -48,7 +48,7 @@ qt5-svg-docs - qt5-base + qt5-base /usr/share/doc @@ -57,6 +57,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-04-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-tools/pspec.xml b/desktop/toolkit/qt5/qt5-tools/pspec.xml index 9fe4749ead..9aa5402f34 100755 --- a/desktop/toolkit/qt5/qt5-tools/pspec.xml +++ b/desktop/toolkit/qt5/qt5-tools/pspec.xml @@ -11,12 +11,12 @@ A cross-platform application and UI framework (Development Tools, QtHelp) A cross-platform application and UI framework (Development Tools, QtHelp) LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qttools-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qttools-everywhere-src-5.13.0.tar.xz llvm mesa-devel llvm-clang-devel - qt5-base-devel + qt5-base-devel icon-theme-hicolor @@ -28,9 +28,12 @@ libgcc llvm-libs llvm-clang - qt5-base + qt5-base + /usr/bin/lprodump + /usr/bin/lrelease-pro + /usr/bin/lupdate-pro /usr/bin/assistant /usr/bin/qhelpgenerator /usr/bin/qhelpconverter @@ -59,7 +62,7 @@ qt5-assistant-devel - qt5-base-devel + qt5-base-devel qt5-assistant llvm-clang-devel @@ -75,7 +78,7 @@ qt5-designer libgcc - qt5-base + qt5-base @@ -170,6 +173,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-05-29 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-translations/pspec.xml b/desktop/toolkit/qt5/qt5-translations/pspec.xml index bced4ba0bf..cf5116534a 100755 --- a/desktop/toolkit/qt5/qt5-translations/pspec.xml +++ b/desktop/toolkit/qt5/qt5-translations/pspec.xml @@ -11,12 +11,12 @@ A cross-platform application and UI framework (Translations) A cross-platform application and UI framework (Translations) LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qttranslations-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qttranslations-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-assistant-devel - qt5-sql-sqlite - qt5-linguist + qt5-base-devel + qt5-assistant-devel + qt5-sql-sqlite + qt5-linguist @@ -27,11 +27,18 @@ /usr/share/licenses/ - qt5-base + qt5-base + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-virtualkeyboard/pspec.xml b/desktop/toolkit/qt5/qt5-virtualkeyboard/pspec.xml index eedcdefeba..cc993e37d1 100755 --- a/desktop/toolkit/qt5/qt5-virtualkeyboard/pspec.xml +++ b/desktop/toolkit/qt5/qt5-virtualkeyboard/pspec.xml @@ -11,11 +11,11 @@ GPL3 Qt module for general purpose serial bus access Virtual keyboard framework - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtvirtualkeyboard-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtvirtualkeyboard-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel - qt5-svg-devel + qt5-base-devel + qt5-declarative-devel + qt5-svg-devel libxcb-devel hunspell-devel @@ -24,9 +24,9 @@ qt5-virtualkeyboard Virtual keyboard framework - qt5-base - qt5-declarative - qt5-svg + qt5-base + qt5-declarative + qt5-svg libgcc libxcb @@ -48,6 +48,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-wayland/pspec.xml b/desktop/toolkit/qt5/qt5-wayland/pspec.xml index 3ba93e78eb..a0e02954c4 100755 --- a/desktop/toolkit/qt5/qt5-wayland/pspec.xml +++ b/desktop/toolkit/qt5/qt5-wayland/pspec.xml @@ -11,10 +11,10 @@ Provides APIs for Wayland Provides APIs for Wayland LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtwayland-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtwayland-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel libxkbcommon-devel xorg-server-xwayland glib2-devel @@ -47,7 +47,7 @@ libX11 libgcc freetype - qt5-base + qt5-base fontconfig libXrender libxkbcommon @@ -55,7 +55,7 @@ wayland-client wayland-cursor wayland-server - qt5-declarative + qt5-declarative /usr/lib @@ -69,7 +69,7 @@ qt5-wayland-devel qt5-wayland - qt5-base-devel + qt5-base-devel /usr/lib/pkgconfig @@ -80,7 +80,7 @@ qt5-wayland-docs - qt5-base + qt5-base /usr/share/doc @@ -88,6 +88,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-webchannel/pspec.xml b/desktop/toolkit/qt5/qt5-webchannel/pspec.xml index a2b6dc1bf6..f17a2e1401 100755 --- a/desktop/toolkit/qt5/qt5-webchannel/pspec.xml +++ b/desktop/toolkit/qt5/qt5-webchannel/pspec.xml @@ -11,12 +11,12 @@ Provides access to QObject or QML objects from HTML clients for seamless integration of Qt applications with HTML/JavaScript clients Provides access to QObject or QML objects from HTML clients for seamless integration of Qt applications with HTML/JavaScript clients LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtwebchannel-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtwebchannel-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel - qt5-assistant-devel - qt5-sql-sqlite + qt5-base-devel + qt5-declarative-devel + qt5-assistant-devel + qt5-sql-sqlite @@ -29,8 +29,8 @@ libgcc - qt5-base - qt5-declarative + qt5-base + qt5-declarative @@ -42,8 +42,8 @@ qt5-webchannel - qt5-base-devel - qt5-declarative-devel + qt5-base-devel + qt5-declarative-devel @@ -54,12 +54,19 @@ libgcc - qt5-base - qt5-declarative + qt5-base + qt5-declarative + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-webengine/pspec.xml b/desktop/toolkit/qt5/qt5-webengine/pspec.xml index 66948a1771..c7e466f8d0 100755 --- a/desktop/toolkit/qt5/qt5-webengine/pspec.xml +++ b/desktop/toolkit/qt5/qt5-webengine/pspec.xml @@ -11,14 +11,14 @@ Provides support for web applications using the Chromium browser project Provides support for web applications using the Chromium browser project LGPLv2.1-linking-exception - http://download.qt.io/official_releases/qt/5.12/5.12.2/submodules/qtwebengine-everywhere-src-5.12.2.tar.xz + http://download.qt.io/official_releases/qt/5.13/5.13.0/submodules/qtwebengine-everywhere-src-5.13.0.tar.xz - qt5-base-devel - qt5-declarative-devel - qt5-xmlpatterns-devel - qt5-location-devel - qt5-sensors-devel - qt5-webchannel-devel + qt5-base-devel + qt5-declarative-devel + qt5-xmlpatterns-devel + qt5-location-devel + qt5-sensors-devel + qt5-webchannel-devel bison re2-devel re2c @@ -74,7 +74,7 @@ poppler-cpp-devel - qtwebengine-harmony.patch + @@ -115,7 +115,7 @@ libopus libxml2 libvpx - qt5-base + qt5-base alsa-lib harfbuzz libevent @@ -125,11 +125,11 @@ libXScrnSaver libXdamage libXrender - qt5-location + qt5-location libXcomposite libjpeg-turbo - qt5-webchannel - qt5-declarative + qt5-webchannel + qt5-declarative zlib minizip protobuf @@ -145,17 +145,17 @@ qt5-webengine - qt5-base-devel - qt5-declarative-devel - qt5-location-devel - qt5-webchannel-devel + qt5-base-devel + qt5-declarative-devel + qt5-location-devel + qt5-webchannel-devel qt5-webengine-docs - qt5-base + qt5-base /usr/share/doc @@ -163,6 +163,13 @@ + + 2019-06-20 + 5.13.0 + Version bump. + Mustafa Cinasal + muscnsl@gmail.com + 2019-03-14 5.12.2 diff --git a/desktop/toolkit/qt5/qt5-webkit/files/qtwebkit-10-06-2019.patch b/desktop/toolkit/qt5/qt5-webkit/files/qtwebkit-10-06-2019.patch new file mode 100644 index 0000000000..9966896276 --- /dev/null +++ b/desktop/toolkit/qt5/qt5-webkit/files/qtwebkit-10-06-2019.patch @@ -0,0 +1,45311 @@ +diff -Nuar a/CMakeLists.txt b/CMakeLists.txt +--- a/CMakeLists.txt 2017-06-04 23:15:53.000000000 +0300 ++++ b/CMakeLists.txt 2019-06-10 00:48:46.000000000 +0300 +@@ -61,6 +61,8 @@ + set(WTF_CPU_ARM 1) + elseif (LOWERCASE_CMAKE_SYSTEM_PROCESSOR MATCHES "^aarch64") + set(WTF_CPU_ARM64 1) ++elseif (LOWERCASE_CMAKE_SYSTEM_PROCESSOR MATCHES "alpha*") ++ set(WTF_CPU_ALPHA 1) + elseif (LOWERCASE_CMAKE_SYSTEM_PROCESSOR MATCHES "^mips") + set(WTF_CPU_MIPS 1) + elseif (LOWERCASE_CMAKE_SYSTEM_PROCESSOR MATCHES "sh4") +diff -Nuar a/dist/changes-5.4.0 b/dist/changes-5.4.0 +--- a/dist/changes-5.4.0 1970-01-01 02:00:00.000000000 +0200 ++++ b/dist/changes-5.4.0 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,56 @@ ++Qt 5.4 introduces many new features and improvements as well as bugfixes ++over the 5.3.x series. For more details, refer to the online documentation ++included in this distribution. The documentation is also available online: ++ ++ http://qt-project.org/doc/qt-5.4 ++ ++The Qt version 5.4 series is binary compatible with the 5.3.x series. ++Applications compiled for 5.3 will continue to run with 5.4. ++ ++Some of the changes listed in this file include issue tracking numbers ++corresponding to tasks in the Qt Bug Tracker: ++ ++ http://bugreports.qt-project.org/ ++ ++Each of these identifiers can be entered in the bug tracker to obtain more ++information about a particular change. ++ ++**************************************************************************** ++* Library * ++**************************************************************************** ++ ++QtWebkit ++-------- ++ ++ - The Qt WebKit module is considered done. Users should consider migrating to Qt WebEngine to keep up with new web features. ++ - [QTBUG-41877] Fixed regression causing network crashes on high bandwidth websites. ++ ++ ++QtWebkitWidgets ++--------------- ++ ++ - Accelerated compositing is now also supported with a QOpenGLWidget as the viewport. ++ - Accelerated 2D Canvas can now be activated to make HTML canvas elements render using the OpenGL painter. ++ ++QtWebkitQML ++----------- ++ ++ - Integration with QWebChannel. ++ ++ ++**************************************************************************** ++* Platform Specific Changes * ++**************************************************************************** ++ ++Windows ++------- ++ ++ - Support for dynamic GL builds. ++ - [QTBUG-42417] Fixed occational crashes in Windows 64-bit JavaScript JIT. ++ ++ ++Machine architectures ++--------------------- ++ ++ - [QTBUG-41896] Fixed common JavaScript crashes on big-endian architectures. ++ - [QTBUG-35681] Low level interpreter is now enabled on softfp ARM ABI if VFP is available. +diff -Nuar a/dist/changes-5.4.1 b/dist/changes-5.4.1 +--- a/dist/changes-5.4.1 1970-01-01 02:00:00.000000000 +0200 ++++ b/dist/changes-5.4.1 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,42 @@ ++Qt 5.4.1 is a bug-fix release. It maintains both forward and backward ++compatibility (source and binary) with Qt 5.4.0. ++ ++For more details, refer to the online documentation included in this ++distribution. The documentation is also available online: ++ ++ http://doc.qt.io/qt-5.4 ++ ++The Qt version 5.4 series is binary compatible with the 5.3.x series. ++Applications compiled for 5.3 will continue to run with 5.4. ++ ++Some of the changes listed in this file include issue tracking numbers ++corresponding to tasks in the Qt Bug Tracker: ++ ++ http://bugreports.qt.io/ ++ ++Each of these identifiers can be entered in the bug tracker to obtain more ++information about a particular change. ++ ++**************************************************************************** ++* Library * ++**************************************************************************** ++ ++QtWebkit ++-------- ++ - [QTBUG-43149] Support for MSIE compatible pasteboard types. ++ - [QTBUG-44024] Fixed memory leak when opening webviews on images. ++ ++ ++**************************************************************************** ++* Platform Specific Changes * ++**************************************************************************** ++ ++Windows ++------- ++ - Fixed various build issues with MSVC. ++ - [QTBUG-43831] Avoid crash if a too old version of OpenGL is being used. ++ ++Linux ++------- ++ - [QTBUG-43520] Optimized HTML5 video by avoiding an unnecessary image transform on every frame. ++ - [QTBUG-43479] Fixed setting system volume to 100% on HTML5 video if channel and system volume have been tied. +diff -Nuar a/dist/changes-5.4.2 b/dist/changes-5.4.2 +--- a/dist/changes-5.4.2 1970-01-01 02:00:00.000000000 +0200 ++++ b/dist/changes-5.4.2 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,54 @@ ++Qt 5.4.2 is a bug-fix release. It maintains both forward and backward ++compatibility (source and binary) with Qt 5.4.1. ++ ++For more details, refer to the online documentation included in this ++distribution. The documentation is also available online: ++ ++ http://doc.qt.io/qt-5.4 ++ ++The Qt version 5.4 series is binary compatible with the 5.3.x series. ++Applications compiled for 5.3 will continue to run with 5.4. ++ ++Some of the changes listed in this file include issue tracking numbers ++corresponding to tasks in the Qt Bug Tracker: ++ ++ http://bugreports.qt.io/ ++ ++Each of these identifiers can be entered in the bug tracker to obtain more ++information about a particular change. ++ ++**************************************************************************** ++* Library * ++**************************************************************************** ++ ++QtWebkit ++-------- ++ - Fixed privacy breaking icon database usage in private browsing mode. ++ - Fixed possible OpenGL crashes on exit. ++ - [QTBUG-44475] Improved performance of initializing large JSON objects. ++ - [QTBUG-44829] Fixed g++5 builds. ++ - [QTBUG-44912] Fixed crash on loading svg.js ++ - [QTBUG-44524] Fixed possible out-of-memory crash and performance issues ++ on some pages caused by very large accelerated layers. ++ - [QTBUG-45299] Fixed segmentation fault in JSC::DFG::prepareOSREntry. ++ ++ ++**************************************************************************** ++* Platform Specific Changes * ++**************************************************************************** ++ ++Windows ++------- ++ - [QTBUG-44401,QTBUG-42588,QTBUG-43024] Forwarding show and hide events so ++ videos in non-visible widgets are hidden. ++ ++ARM ++------- ++ - [QTBUG-44700] Fixed JavaScript crash caused by misbehaving gold linker. ++ - [QTBUG-44740] Fixed alignment issue in WebKit2 IPC. ++ ++Linux ++------- ++ - [QTBUG-44245] Fixed crash on some HTML5 videos caused by invalid ++ frame-data from GStreamer. ++ - [QTBUG-44714] Fixed linking with glib 2.43 and newer. +diff -Nuar a/dist/changes-5.5.0 b/dist/changes-5.5.0 +--- a/dist/changes-5.5.0 1970-01-01 02:00:00.000000000 +0200 ++++ b/dist/changes-5.5.0 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,53 @@ ++Qt 5.5 introduces many new features and improvements as well as bugfixes ++over the 5.4.x series. ++ ++For more details, refer to the online documentation included in this ++distribution. The documentation is also available online: ++ ++ http://doc.qt.io/qt-5.5 ++ ++The Qt version 5.5 series is binary compatible with the 5.4.x series. ++Applications compiled for 5.4 will continue to run with 5.5. ++ ++Some of the changes listed in this file include issue tracking numbers ++corresponding to tasks in the Qt Bug Tracker: ++ ++ http://bugreports.qt.io/ ++ ++Each of these identifiers can be entered in the bug tracker to obtain more ++information about a particular change. ++ ++**************************************************************************** ++* Important * ++**************************************************************************** ++ ++- QtWebKit is now deprecated. It will continue to be supported in Qt 5, but ++it is recommended new projects switch to the QtWebEngine APIs. ++ ++ ++**************************************************************************** ++* Library * ++**************************************************************************** ++ ++QtWebkit ++-------- ++ - [QTBUG-45556] Fixed case where local pages could request remote content ++ when remote access was disabled. ++ - Support for more font-weight using new weight in QFont. ++ - [QTBUG-43628] Support authentication of POST requests. ++ ++ ++**************************************************************************** ++* Platform Specific Changes * ++**************************************************************************** ++ ++Windows ++------- ++ - [QTBUG-46344] Support building with MSVC 2015 ++ ++Linux ++------- ++ - NS plugins are now linking using RTLD_DEEPBIND, making it possible to ++ load plugins using conflicting symbols such as Qt4 libraries. ++ - Plugins loading Qt4-using plugins of their own without using deepbind ++ are blacklisted. +diff -Nuar a/dist/changes-5.6.0 b/dist/changes-5.6.0 +--- a/dist/changes-5.6.0 1970-01-01 02:00:00.000000000 +0200 ++++ b/dist/changes-5.6.0 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,51 @@ ++Qt 5.6 introduces many new features and improvements as well as bugfixes ++over the 5.5.x series. ++ ++For more details, refer to the online documentation included in this ++distribution. The documentation is also available online: ++ ++ http://doc.qt.io/qt-5.6 ++ ++The Qt version 5.6 series is binary compatible with the 5.5.x series. ++Applications compiled for 5.5 will continue to run with 5.6. ++ ++Some of the changes listed in this file include issue tracking numbers ++corresponding to tasks in the Qt Bug Tracker: ++ ++ http://bugreports.qt.io/ ++ ++Each of these identifiers can be entered in the bug tracker to obtain more ++information about a particular change. ++ ++ ++**************************************************************************** ++* Important Behavior Changes * ++**************************************************************************** ++ ++ - The quality parameter in canvas.toDataURL only applies to JPEG images ++ now, in accordance with section 4.12.4.4 of the HTML5 spec. ++ ++**************************************************************************** ++* Library * ++**************************************************************************** ++ ++QtWebkit ++-------- ++ - [QTBUG-44563] Render anchors as clickable links in PDF documents ++ - % unit heights didn't work if parent block height was set in vh ++ - Fixed regression: some errors were not reported to ErrorPageExtension ++ ++QtWebkitQML ++----------- ++ - WebView.experimental got several features which were previously available ++ only via widgets API: spatial navigation, links included in focus chain, ++ and user style sheets ++ - Fixed missing text in QQuickItem::inputMethodQuery when text element is ++ focused in WebView ++ ++ ++**************************************************************************** ++* Platform Specific Changes * ++**************************************************************************** ++ ++- Various build fixes +diff -Nuar a/dist/changes-5.6.1 b/dist/changes-5.6.1 +--- a/dist/changes-5.6.1 1970-01-01 02:00:00.000000000 +0200 ++++ b/dist/changes-5.6.1 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,49 @@ ++Qt 5.6.1 is a bug-fix release. It maintains both forward and backward ++compatibility (source and binary) with Qt 5.6.0. ++ ++For more details, refer to the online documentation included in this ++distribution. The documentation is also available online: ++ ++ http://doc.qt.io/qt-5.6 ++ ++The Qt version 5.6 series is binary compatible with the 5.5.x series. ++Applications compiled for 5.5 will continue to run with 5.6. ++ ++Some of the changes listed in this file include issue tracking numbers ++corresponding to tasks in the Qt Bug Tracker: ++ ++ http://bugreports.qt.io/ ++ ++Each of these identifiers can be entered in the bug tracker to obtain more ++information about a particular change. ++ ++ ++**************************************************************************** ++* Important Behavior Changes * ++**************************************************************************** ++ ++ - QtWebKit will no longer support any QImageIO plugin with the Size option, ++ but instead only decode formats that have been whitelisted. If you are ++ using QtWebKit for controlled content and wish to override the white list ++ it can now be done with the environment variable ++ QTWEBKIT_IMAGEFORMAT_WHITELIST which takes a comma-separated list of ++ QImageIO formats. ++ ++**************************************************************************** ++* Library * ++**************************************************************************** ++ ++QtWebkit ++-------- ++ - Fixed memory leaks and crashes related to SVG animated properties. ++ - Fixed compilation with libjpeg v9. ++ ++ ++**************************************************************************** ++* Platform Specific Changes * ++**************************************************************************** ++ ++Windows ++------- ++- QtWebKit does not require Qt configured with ICU support anymore to be ++ built. +diff -Nuar a/README b/README +--- a/README 1970-01-01 02:00:00.000000000 +0200 ++++ b/README 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,15 @@ ++# Qt Port of WebKit ++ ++WebKit is an open source web browser engine. WebKit's HTML and JavaScript code began as a branch of the KHTML and KJS libraries from KDE. As part of KDE framework KHTML was based on Qt but during their porting efforts Apple's engineers made WebKit toolkit independent. QtWebKit is a project aiming at porting this fabulous engine back to Qt. ++ ++The Qt port of WebKit currently compiles and runs on Linux, *BSD, Windows and macOS. ++ ++# Building ++ ++See instructions at https://github.com/annulen/webkit/wiki ++ ++# Contacts ++ ++* Mailing list: webkit-qt@lists.webkit.org ++* IRC: #qtwebkit on irc.freenode.net ++* Blog: http://qtwebkit.blogspot.com +diff -Nuar a/Source/bmalloc/bmalloc/BPlatform.h b/Source/bmalloc/bmalloc/BPlatform.h +--- a/Source/bmalloc/bmalloc/BPlatform.h 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/bmalloc/bmalloc/BPlatform.h 2019-06-10 00:48:46.000000000 +0300 +@@ -120,7 +120,8 @@ + || defined(__ARM_ARCH_7S__) + #define BARM_ARCH_VERSION 7 + +-#elif defined(__ARM_ARCH_8__) ++#elif defined(__ARM_ARCH_8__) \ ++|| defined(__ARM_ARCH_8A__) + #define BARM_ARCH_VERSION 8 + + /* MSVC sets _M_ARM */ +diff -Nuar a/Source/cmake/ECMEnableSanitizers.cmake b/Source/cmake/ECMEnableSanitizers.cmake +--- a/Source/cmake/ECMEnableSanitizers.cmake 1970-01-01 02:00:00.000000000 +0200 ++++ b/Source/cmake/ECMEnableSanitizers.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,173 @@ ++#.rst: ++# ECMEnableSanitizers ++# ------------------- ++# ++# Enable compiler sanitizer flags. ++# ++# The following sanitizers are supported: ++# ++# - Address Sanitizer ++# - Memory Sanitizer ++# - Thread Sanitizer ++# - Leak Sanitizer ++# - Undefined Behaviour Sanitizer ++# ++# All of them are implemented in Clang, depending on your version, and ++# there is an work in progress in GCC, where some of them are currently ++# implemented. ++# ++# This module will check your current compiler version to see if it ++# supports the sanitizers that you want to enable ++# ++# Usage ++# ===== ++# ++# Simply add:: ++# ++# include(ECMEnableSanitizers) ++# ++# to your ``CMakeLists.txt``. Note that this module is included in ++# KDECompilerSettings, so projects using that module do not need to also ++# include this one. ++# ++# The sanitizers are not enabled by default. Instead, you must set ++# ``ECM_ENABLE_SANITIZERS`` (either in your ``CMakeLists.txt`` or on the ++# command line) to a semicolon-separated list of sanitizers you wish to enable. ++# The options are: ++# ++# - address ++# - memory ++# - thread ++# - leak ++# - undefined ++# ++# The sanitizers "address", "memory" and "thread" are mutually exclusive. You ++# cannot enable two of them in the same build. ++# ++# "leak" requires the "address" sanitizer. ++# ++# .. note:: ++# ++# To reduce the overhead induced by the instrumentation of the sanitizers, it ++# is advised to enable compiler optimizations (``-O1`` or higher). ++# ++# Example ++# ======= ++# ++# This is an example of usage:: ++# ++# mkdir build ++# cd build ++# cmake -DECM_ENABLE_SANITIZERS='address;leak;undefined' .. ++# ++# .. note:: ++# ++# Most of the sanitizers will require Clang. To enable it, use:: ++# ++# -DCMAKE_CXX_COMPILER=clang++ ++# ++# Since 1.3.0. ++ ++#============================================================================= ++# Copyright 2014 Mathieu Tarral ++# ++# Redistribution and use in source and binary forms, with or without ++# modification, are permitted provided that the following conditions ++# are met: ++# ++# 1. Redistributions of source code must retain the copyright ++# notice, this list of conditions and the following disclaimer. ++# 2. Redistributions in binary form must reproduce the copyright ++# notice, this list of conditions and the following disclaimer in the ++# documentation and/or other materials provided with the distribution. ++# 3. The name of the author may not be used to endorse or promote products ++# derived from this software without specific prior written permission. ++# ++# THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR ++# IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES ++# OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. ++# IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, ++# INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT ++# NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, ++# DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY ++# THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT ++# (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF ++# THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ++ ++# MACRO check_compiler_version ++#----------------------------- ++macro (check_compiler_version gcc_required_version clang_required_version) ++ if ( ++ ( ++ CMAKE_CXX_COMPILER_ID MATCHES "GNU" ++ AND ++ CMAKE_CXX_COMPILER_VERSION VERSION_LESS ${gcc_required_version} ++ ) ++ OR ++ ( ++ CMAKE_CXX_COMPILER_ID MATCHES "Clang" ++ AND ++ CMAKE_CXX_COMPILER_VERSION VERSION_LESS ${clang_required_version} ++ ) ++ ) ++ # error ! ++ message(FATAL_ERROR "You ask to enable the sanitizer ${CUR_SANITIZER}, ++ but your compiler ${CMAKE_CXX_COMPILER_ID} version ${CMAKE_CXX_COMPILER_VERSION} ++ does not support it ! ++ You should use at least GCC ${gcc_required_version} or Clang ${clang_required_version} ++ (99.99 means not implemented yet)") ++ endif () ++endmacro () ++ ++# MACRO check_compiler_support ++#------------------------------ ++macro (enable_sanitizer_flags sanitize_option) ++ if (${sanitize_option} MATCHES "address") ++ check_compiler_version("4.8" "3.1") ++ set(XSAN_COMPILE_FLAGS "-fsanitize=address -fno-omit-frame-pointer -fno-optimize-sibling-calls") ++ set(XSAN_LINKER_FLAGS "asan") ++ elseif (${sanitize_option} MATCHES "thread") ++ check_compiler_version("4.8" "3.1") ++ set(XSAN_COMPILE_FLAGS "-fsanitize=thread") ++ set(XSAN_LINKER_FLAGS "tsan") ++ elseif (${sanitize_option} MATCHES "memory") ++ check_compiler_version("99.99" "3.1") ++ set(XSAN_COMPILE_FLAGS "-fsanitize=memory") ++ elseif (${sanitize_option} MATCHES "leak") ++ check_compiler_version("4.9" "3.4") ++ set(XSAN_COMPILE_FLAGS "-fsanitize=leak") ++ set(XSAN_LINKER_FLAGS "lsan") ++ elseif (${sanitize_option} MATCHES "undefined") ++ check_compiler_version("4.9" "3.1") ++ set(XSAN_COMPILE_FLAGS "-fsanitize=undefined -fno-omit-frame-pointer -fno-optimize-sibling-calls") ++ else () ++ message(FATAL_ERROR "Compiler sanitizer option \"${sanitize_option}\" not supported.") ++ endif () ++endmacro () ++ ++if (ECM_ENABLE_SANITIZERS) ++ if (CMAKE_CXX_COMPILER_ID MATCHES "GNU" OR CMAKE_CXX_COMPILER_ID MATCHES "Clang") ++ # for each element of the ECM_ENABLE_SANITIZERS list ++ foreach ( CUR_SANITIZER ${ECM_ENABLE_SANITIZERS} ) ++ # lowercase filter ++ string(TOLOWER ${CUR_SANITIZER} CUR_SANITIZER) ++ # check option and enable appropriate flags ++ enable_sanitizer_flags ( ${CUR_SANITIZER} ) ++ # TODO: GCC will not link pthread library if enabled ASan ++ if(CMAKE_C_COMPILER_ID MATCHES "Clang") ++ set( CMAKE_C_FLAGS "${CMAKE_C_FLAGS} ${XSAN_COMPILE_FLAGS}" ) ++ endif() ++ set( CMAKE_CXX_FLAGS "${CMAKE_CXX_FLAGS} ${XSAN_COMPILE_FLAGS}" ) ++ if(CMAKE_CXX_COMPILER_ID MATCHES "GNU") ++ link_libraries(${XSAN_LINKER_FLAGS}) ++ endif() ++ if (CMAKE_CXX_COMPILER_ID STREQUAL "Clang") ++ string(REPLACE "-Wl,--no-undefined" "" CMAKE_SHARED_LINKER_FLAGS "${CMAKE_SHARED_LINKER_FLAGS}") ++ string(REPLACE "-Wl,--no-undefined" "" CMAKE_MODULE_LINKER_FLAGS "${CMAKE_MODULE_LINKER_FLAGS}") ++ endif () ++ endforeach() ++ else() ++ message(STATUS "Tried to enable sanitizers (-DECM_ENABLE_SANITIZERS=${ECM_ENABLE_SANITIZERS}), \ ++but compiler (${CMAKE_CXX_COMPILER_ID}) does not have sanitizer support") ++ endif() ++endif() +diff -Nuar a/Source/cmake/ECMGeneratePkgConfigFile.cmake b/Source/cmake/ECMGeneratePkgConfigFile.cmake +--- a/Source/cmake/ECMGeneratePkgConfigFile.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/ECMGeneratePkgConfigFile.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -16,6 +16,7 @@ + # [INCLUDE_INSTALL_DIR ] + # [LIB_INSTALL_DIR ] + # [DEFINES -D...] ++# [DESCRIPTION ] + # [INSTALL]) + # + # ``BASE_NAME`` is the name of the module. It's the name projects will use to +@@ -42,6 +43,10 @@ + # ``DEFINES`` is a list of preprocessor defines that it is recommended users of + # the library pass to the compiler when using it. + # ++# ``DESCRIPTION`` describes what this library is. If it's not specified, CMake ++# will first try to get the description from the metainfo.yaml file or will ++# create one based on ``LIB_NAME``. ++# + # ``INSTALL`` will cause the module to be installed to the ``pkgconfig`` + # subdirectory of ``LIB_INSTALL_DIR``, unless the ``ECM_PKGCONFIG_INSTALL_DIR`` + # cache variable is set to something different. Note that the first call to +@@ -66,24 +71,39 @@ + # ) + # + # Since 1.3.0. ++# ``DESCRIPTION`` available since 5.1.41 ++# + + #============================================================================= + # Copyright 2014 Aleix Pol Gonzalez + # Copyright 2014 David Faure + # +-# Distributed under the OSI-approved BSD License (the "License"); +-# see accompanying file COPYING-CMAKE-SCRIPTS for details. +-# +-# This software is distributed WITHOUT ANY WARRANTY; without even the +-# implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. +-# See the License for more information. +-#============================================================================= +-# (To distribute this file outside of extra-cmake-modules, substitute the full +-# License text for the above reference.) ++# Redistribution and use in source and binary forms, with or without ++# modification, are permitted provided that the following conditions ++# are met: ++# ++# 1. Redistributions of source code must retain the copyright ++# notice, this list of conditions and the following disclaimer. ++# 2. Redistributions in binary form must reproduce the copyright ++# notice, this list of conditions and the following disclaimer in the ++# documentation and/or other materials provided with the distribution. ++# 3. The name of the author may not be used to endorse or promote products ++# derived from this software without specific prior written permission. ++# ++# THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR ++# IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES ++# OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. ++# IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, ++# INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT ++# NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, ++# DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY ++# THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT ++# (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF ++# THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + + function(ECM_GENERATE_PKGCONFIG_FILE) + set(options INSTALL) +- set(oneValueArgs BASE_NAME LIB_NAME FILENAME_VAR INCLUDE_INSTALL_DIR LIB_INSTALL_DIR) ++ set(oneValueArgs BASE_NAME LIB_NAME FILENAME_VAR INCLUDE_INSTALL_DIR LIB_INSTALL_DIR DESCRIPTION) + set(multiValueArgs DEPS DEFINES) + + cmake_parse_arguments(EGPF "${options}" "${oneValueArgs}" "${multiValueArgs}" ${ARGN}) +@@ -119,6 +139,17 @@ + set(EGPF_LIB_INSTALL_DIR "lib") + endif() + endif() ++ if(NOT EGPF_DESCRIPTION) ++ if(EXISTS ${CMAKE_SOURCE_DIR}/metainfo.yaml) ++ file(STRINGS "${CMAKE_SOURCE_DIR}/metainfo.yaml" _EGPF_METAINFO_DESCRIPTION_STRING REGEX "^description:.*$") ++ if(_EGPF_METAINFO_DESCRIPTION_STRING) ++ string(REGEX REPLACE "^description:[ ]*(.*)" "\\1" EGPF_DESCRIPTION ${_EGPF_METAINFO_DESCRIPTION_STRING}) ++ endif() ++ endif() ++ if("${EGPF_DESCRIPTION}" STREQUAL "") ++ set(EGPF_DESCRIPTION "${EGPF_LIB_NAME} library.") ++ endif() ++ endif() + + set(PKGCONFIG_TARGET_BASENAME ${EGPF_BASE_NAME}) + set(PKGCONFIG_TARGET_LIBNAME ${EGPF_LIB_NAME}) +@@ -135,6 +166,7 @@ + else() + set(PKGCONFIG_TARGET_LIBS "${CMAKE_INSTALL_PREFIX}/${EGPF_LIB_INSTALL_DIR}") + endif() ++ set(PKGCONFIG_TARGET_DESCRIPTION "${EGPF_DESCRIPTION}") + set(PKGCONFIG_TARGET_DEFINES "") + if(EGPF_DEFINES) + set(PKGCONFIG_TARGET_DEFINES "${EGPF_DEFINE}") +@@ -148,6 +180,7 @@ + file(WRITE ${PKGCONFIG_FILENAME} + " + Name: ${PKGCONFIG_TARGET_LIBNAME} ++Description: ${PKGCONFIG_TARGET_DESCRIPTION} + Version: ${PROJECT_VERSION} + Libs: -L${CMAKE_INSTALL_PREFIX}/${EGPF_LIB_INSTALL_DIR} -l${PKGCONFIG_TARGET_LIBNAME} + Cflags: ${PKGCONFIG_TARGET_INCLUDES} ${PKGCONFIG_TARGET_DEFINES} +@@ -156,8 +189,11 @@ + ) + + if(EGPF_INSTALL) +- set(ECM_PKGCONFIG_INSTALL_DIR "${EGPF_LIB_INSTALL_DIR}/pkgconfig" CACHE PATH "The directory where pkgconfig will be installed to.") ++ if(CMAKE_SYSTEM_NAME MATCHES "FreeBSD") ++ set(ECM_PKGCONFIG_INSTALL_DIR "${CMAKE_INSTALL_PREFIX}/libdata/pkgconfig" CACHE PATH "The directory where pkgconfig will be installed to.") ++ else() ++ set(ECM_PKGCONFIG_INSTALL_DIR "${EGPF_LIB_INSTALL_DIR}/pkgconfig" CACHE PATH "The directory where pkgconfig will be installed to.") ++ endif() + install(FILES ${PKGCONFIG_FILENAME} DESTINATION ${ECM_PKGCONFIG_INSTALL_DIR}) + endif() + endfunction() +- +diff -Nuar a/Source/cmake/FindGeoClue2.cmake b/Source/cmake/FindGeoClue2.cmake +--- a/Source/cmake/FindGeoClue2.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/FindGeoClue2.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -48,4 +48,5 @@ + endif () + + include(FindPackageHandleStandardArgs) +-FIND_PACKAGE_HANDLE_STANDARD_ARGS(GEOCLUE2 DEFAULT_MSG VERSION_OK) ++find_package_handle_standard_args(GeoClue2 REQUIRED_VARS VERSION_OK ++ FOUND_VAR GEOCLUE2_FOUND) +diff -Nuar a/Source/cmake/FindGTKUnixPrint.cmake b/Source/cmake/FindGTKUnixPrint.cmake +--- a/Source/cmake/FindGTKUnixPrint.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/FindGTKUnixPrint.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -1,7 +1,7 @@ + # - Try to find gtk-unix-print + # Once done, this will define + # +-# GTK_UNIX_PRINT_FOUND - system has gtk-unix-print ++# GTKUnixPrint_FOUND - system has gtk-unix-print + # GTK_UNIX_PRINT_INCLUDE_DIRS - the gtk-unix-print include directories + # GTK_UNIX_PRINT_LIBRARIES - link these to use gtk-unix-print + # +@@ -46,4 +46,4 @@ + endif () + + include(FindPackageHandleStandardArgs) +-FIND_PACKAGE_HANDLE_STANDARD_ARGS(GTK_UNIX_PRINT DEFAULT_MSG GTK_UNIX_PRINT_INCLUDE_DIRS GTK_UNIX_PRINT_LIBRARIES VERSION_OK) ++find_package_handle_standard_args(GTKUnixPrint REQUIRED_VARS GTK_UNIX_PRINT_INCLUDE_DIRS GTK_UNIX_PRINT_LIBRARIES VERSION_OK) +diff -Nuar a/Source/cmake/FindHyphen.cmake b/Source/cmake/FindHyphen.cmake +--- a/Source/cmake/FindHyphen.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/FindHyphen.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -34,7 +34,8 @@ + find_library(HYPHEN_LIBRARIES NAMES hyphen hnj) + + include(FindPackageHandleStandardArgs) +-FIND_PACKAGE_HANDLE_STANDARD_ARGS(HYPHEN DEFAULT_MSG HYPHEN_INCLUDE_DIR HYPHEN_LIBRARIES) ++find_package_handle_standard_args(Hyphen REQUIRED_VARS HYPHEN_INCLUDE_DIR HYPHEN_LIBRARIES ++ FOUND_VAR HYPHEN_FOUND) + + if (HYPHEN_INCLUDE_DIR AND HYPHEN_LIBRARIES) + set(HYPHEN_FOUND 1) +diff -Nuar a/Source/cmake/FindLibsecret.cmake b/Source/cmake/FindLibsecret.cmake +--- a/Source/cmake/FindLibsecret.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/FindLibsecret.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -46,4 +46,5 @@ + endif () + + include(FindPackageHandleStandardArgs) +-FIND_PACKAGE_HANDLE_STANDARD_ARGS(LIBSECRET DEFAULT_MSG LIBSECRET_INCLUDE_DIRS LIBSECRET_LIBRARIES VERSION_OK) ++find_package_handle_standard_args(Libsecret REQUIRED_VARS LIBSECRET_INCLUDE_DIRS LIBSECRET_LIBRARIES VERSION_OK ++ FOUND_VAR LIBSECRET_FOUND) +diff -Nuar a/Source/cmake/FindOpenGL.cmake b/Source/cmake/FindOpenGL.cmake +--- a/Source/cmake/FindOpenGL.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/FindOpenGL.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -48,7 +48,8 @@ + ) + + include(FindPackageHandleStandardArgs) +-FIND_PACKAGE_HANDLE_STANDARD_ARGS(OPENGL DEFAULT_MSG OPENGL_INCLUDE_DIRS OPENGL_LIBRARIES) ++find_package_handle_standard_args(OpenGL REQUIRED_VARS OPENGL_INCLUDE_DIRS OPENGL_LIBRARIES ++ FOUND_VAR OPENGL_FOUND) + + mark_as_advanced(OPENGL_INCLUDE_DIRS OPENGL_LIBRARIES) + +diff -Nuar a/Source/cmake/FindOpenGLES2.cmake b/Source/cmake/FindOpenGLES2.cmake +--- a/Source/cmake/FindOpenGLES2.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/FindOpenGLES2.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -22,6 +22,7 @@ + ) + + include(FindPackageHandleStandardArgs) +-FIND_PACKAGE_HANDLE_STANDARD_ARGS(OPENGLES2 DEFAULT_MSG OPENGLES2_INCLUDE_DIRS OPENGLES2_LIBRARIES) ++find_package_handle_standard_args(OpenGLES2 REQUIRED_VARS OPENGLES2_INCLUDE_DIRS OPENGLES2_LIBRARIES ++ FOUND_VAR OPENGLES2_FOUND) + + mark_as_advanced(OPENGLES2_INCLUDE_DIRS OPENGLES2_LIBRARIES) +diff -Nuar a/Source/cmake/FindOpenWebRTC.cmake b/Source/cmake/FindOpenWebRTC.cmake +--- a/Source/cmake/FindOpenWebRTC.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/FindOpenWebRTC.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -46,4 +46,5 @@ + endif () + + include(FindPackageHandleStandardArgs) +-FIND_PACKAGE_HANDLE_STANDARD_ARGS(OPENWEBRTC DEFAULT_MSG OPENWEBRTC_INCLUDE_DIRS OPENWEBRTC_LIBRARIES VERSION_OK) ++find_package_handle_standard_args(OpenWebRTC REQUIRED_VARS OPENWEBRTC_INCLUDE_DIRS OPENWEBRTC_LIBRARIES VERSION_OK ++ FOUND_VAR OPENWEBRTC_FOUND) +diff -Nuar a/Source/cmake/FindWayland.cmake b/Source/cmake/FindWayland.cmake +--- a/Source/cmake/FindWayland.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/FindWayland.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -32,4 +32,5 @@ + pkg_check_modules(WAYLAND wayland-client wayland-server wayland-egl) + + include(FindPackageHandleStandardArgs) +-FIND_PACKAGE_HANDLE_STANDARD_ARGS(WAYLAND DEFAULT_MSG WAYLAND_LIBRARIES) ++find_package_handle_standard_args(Wayland REQUIRED_VARS WAYLAND_LIBRARIES ++ FOUND_VAR WAYLAND_FOUND) +diff -Nuar a/Source/cmake/FindWebP.cmake b/Source/cmake/FindWebP.cmake +--- a/Source/cmake/FindWebP.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/FindWebP.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -48,4 +48,5 @@ + mark_as_advanced(WEBP_LIBRARIES) + + include(FindPackageHandleStandardArgs) +-FIND_PACKAGE_HANDLE_STANDARD_ARGS(WEBP DEFAULT_MSG WEBP_INCLUDE_DIRS WEBP_LIBRARIES) ++find_package_handle_standard_args(WebP REQUIRED_VARS WEBP_INCLUDE_DIRS WEBP_LIBRARIES ++ FOUND_VAR WEBP_FOUND) +diff -Nuar a/Source/cmake/FindWOFF2Dec.cmake b/Source/cmake/FindWOFF2Dec.cmake +--- a/Source/cmake/FindWOFF2Dec.cmake 1970-01-01 02:00:00.000000000 +0200 ++++ b/Source/cmake/FindWOFF2Dec.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,53 @@ ++# - Try to find WOFF2Dec. ++# Once done, this will define ++# ++# WOFF2DEC_FOUND - system has WOFF2Dec. ++# WOFF2DEC_INCLUDE_DIRS - the WOFF2Dec include directories ++# WOFF2DEC_LIBRARIES - link these to use WOFF2Dec. ++# ++# Copyright (C) 2017 Igalia S.L. ++# ++# Redistribution and use in source and binary forms, with or without ++# modification, are permitted provided that the following conditions ++# are met: ++# 1. Redistributions of source code must retain the above copyright ++# notice, this list of conditions and the following disclaimer. ++# 2. Redistributions in binary form must reproduce the above copyright ++# notice, this list of conditions and the following disclaimer in the ++# documentation and/or other materials provided with the distribution. ++# ++# THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDER AND ITS CONTRIBUTORS ``AS ++# IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, ++# THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR ++# PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR ITS ++# CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, ++# EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, ++# PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; ++# OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, ++# WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR ++# OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ++# ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ++ ++find_package(PkgConfig) ++pkg_check_modules(PC_WOFF2DEC libwoff2dec) ++ ++find_path(WOFF2DEC_INCLUDE_DIRS ++ NAMES woff2/decode.h ++ HINTS ${PC_WOFF2DEC_INCLUDEDIR} ++) ++ ++find_library(WOFF2DEC_LIBRARIES ++ NAMES woff2dec ++ HINTS ${PC_WOFF2DEC_LIBDIR} ++) ++ ++include(FindPackageHandleStandardArgs) ++find_package_handle_standard_args(WOFF2Dec ++ REQUIRED_VARS WOFF2DEC_INCLUDE_DIRS WOFF2DEC_LIBRARIES ++ FOUND_VAR WOFF2DEC_FOUND ++ VERSION_VAR PC_WOFF2DEC_VERSION) ++ ++mark_as_advanced( ++ WOFF2DEC_INCLUDE_DIRS ++ WOFF2DEC_LIBRARIES ++) +diff -Nuar a/Source/cmake/OptionsCommon.cmake b/Source/cmake/OptionsCommon.cmake +--- a/Source/cmake/OptionsCommon.cmake 2017-06-15 14:56:11.000000000 +0300 ++++ b/Source/cmake/OptionsCommon.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -32,10 +32,6 @@ + set(CMAKE_C_FLAGS "${CMAKE_C_FLAGS} -fno-exceptions -fno-strict-aliasing") + set(CMAKE_CXX_FLAGS "${CMAKE_CXX_FLAGS} -fno-exceptions -fno-strict-aliasing -fno-rtti") + set(CMAKE_CXX_FLAGS "${CMAKE_CXX_FLAGS} -std=c++11") +- if (NOT (COMPILER_IS_CLANG AND "${CLANG_VERSION}" VERSION_LESS 4.0.0)) +- set(CMAKE_C_FLAGS "${CMAKE_C_FLAGS} -Wno-expansion-to-defined") +- set(CMAKE_CXX_FLAGS "${CMAKE_CXX_FLAGS} -Wno-expansion-to-defined") +- endif () + endif () + + if (COMPILER_IS_CLANG AND CMAKE_GENERATOR STREQUAL "Ninja") +diff -Nuar a/Source/cmake/OptionsQt.cmake b/Source/cmake/OptionsQt.cmake +--- a/Source/cmake/OptionsQt.cmake 2017-06-16 02:36:48.000000000 +0300 ++++ b/Source/cmake/OptionsQt.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -1,4 +1,6 @@ ++include(CheckCXXSourceCompiles) + include(FeatureSummary) ++include(ECMEnableSanitizers) + include(ECMPackageConfigHelpers) + + set(ECM_MODULE_DIR ${CMAKE_MODULE_PATH}) +@@ -52,6 +54,30 @@ + endif () + endmacro() + ++macro(CHECK_QT5_PRIVATE_INCLUDE_DIRS _qt_component _header) ++ set(INCLUDE_TEST_SOURCE ++ " ++ #include <${_header}> ++ int main() { return 0; } ++ " ++ ) ++ set(CMAKE_REQUIRED_INCLUDES ${Qt5${_qt_component}_PRIVATE_INCLUDE_DIRS}) ++ set(CMAKE_REQUIRED_LIBRARIES Qt5::${_qt_component}) ++ ++ # Avoid check_include_file_cxx() because it performs linking but doesn't support CMAKE_REQUIRED_LIBRARIES (doh!) ++ check_cxx_source_compiles("${INCLUDE_TEST_SOURCE}" Qt5${_qt_component}_PRIVATE_HEADER_FOUND) ++ ++ unset(INCLUDE_TEST_SOURCE) ++ unset(CMAKE_REQUIRED_INCLUDES) ++ unset(CMAKE_REQUIRED_LIBRARIES) ++ ++ if (NOT Qt5${_qt_component}_PRIVATE_HEADER_FOUND) ++ message(FATAL_ERROR "Header ${_header} is not found. Please make sure that: ++ 1. Private headers of Qt5${_qt_component} are installed ++ 2. Qt5${_qt_component}_PRIVATE_INCLUDE_DIRS is correctly defined in Qt5${_qt_component}Config.cmake") ++ endif () ++endmacro() ++ + macro(QT_ADD_EXTRA_WEBKIT_TARGET_EXPORT target) + if (QT_STATIC_BUILD OR SHARED_CORE) + install(TARGETS ${target} EXPORT WebKitTargets +@@ -59,7 +85,16 @@ + endif () + endmacro() + +-macro(QTWEBKIT_GENERATE_MOC_FILES_CPP) ++macro(QTWEBKIT_SKIP_AUTOMOC _target) ++ foreach (_src ${${_target}_SOURCES}) ++ set_property(SOURCE ${_src} PROPERTY SKIP_AUTOMOC ON) ++ endforeach () ++endmacro() ++ ++macro(QTWEBKIT_GENERATE_MOC_FILES_CPP _target) ++ if (${ARGC} LESS 2) ++ message(FATAL_ERROR "QTWEBKIT_GENERATE_MOC_FILES_CPP must be called with at least 2 arguments") ++ endif () + foreach (_file ${ARGN}) + get_filename_component(_ext ${_file} EXT) + if (NOT _ext STREQUAL ".cpp") +@@ -67,12 +102,12 @@ + endif () + get_filename_component(_name_we ${_file} NAME_WE) + set(_moc_name "${CMAKE_CURRENT_BINARY_DIR}/${_name_we}.moc") +- qt5_generate_moc(${_file} ${_moc_name}) ++ qt5_generate_moc(${_file} ${_moc_name} TARGET ${_target}) + ADD_SOURCE_DEPENDENCIES(${_file} ${_moc_name}) + endforeach () + endmacro() + +-macro(QTWEBKIT_GENERATE_MOC_FILE_H _header _source) ++macro(QTWEBKIT_GENERATE_MOC_FILE_H _target _header _source) + get_filename_component(_header_ext ${_header} EXT) + get_filename_component(_source_ext ${_source} EXT) + if ((NOT _header_ext STREQUAL ".h") OR (NOT _source_ext STREQUAL ".cpp")) +@@ -80,16 +115,19 @@ + endif () + get_filename_component(_name_we ${_header} NAME_WE) + set(_moc_name "${CMAKE_CURRENT_BINARY_DIR}/moc_${_name_we}.cpp") +- qt5_generate_moc(${_header} ${_moc_name}) ++ qt5_generate_moc(${_header} ${_moc_name} TARGET ${_target}) + ADD_SOURCE_DEPENDENCIES(${_source} ${_moc_name}) + endmacro() + +-macro(QTWEBKIT_GENERATE_MOC_FILES_H) ++macro(QTWEBKIT_GENERATE_MOC_FILES_H _target) ++ if (${ARGC} LESS 2) ++ message(FATAL_ERROR "QTWEBKIT_GENERATE_MOC_FILES_H must be called with at least 2 arguments") ++ endif () + foreach (_header ${ARGN}) + get_filename_component(_header_dir ${_header} DIRECTORY) + get_filename_component(_name_we ${_header} NAME_WE) + set(_source "${_header_dir}/${_name_we}.cpp") +- QTWEBKIT_GENERATE_MOC_FILE_H(${_header} ${_source}) ++ QTWEBKIT_GENERATE_MOC_FILE_H(${_target} ${_header} ${_source}) + endforeach () + endmacro() + +@@ -118,8 +156,18 @@ + WEBKIT_OPTION_BEGIN() + + if (APPLE) ++ set(MACOS_COMPATIBILITY_VERSION "${PROJECT_VERSION_MAJOR}.${PROJECT_VERSION_MINOR}" CACHE STRING "Compatibility version that macOS dylibs should have") ++ + option(MACOS_FORCE_SYSTEM_XML_LIBRARIES "Use system installation of libxml2 and libxslt on macOS" ON) +- set(MACOS_BUILD_FRAMEWORKS ON) # TODO: Make it an option ++ option(MACOS_USE_SYSTEM_ICU "Use system installation of ICU on macOS" ON) ++ option(USE_UNIX_DOMAIN_SOCKETS "Use Unix domain sockets instead of native IPC code on macOS" OFF) ++ option(USE_APPSTORE_COMPLIANT_CODE "Avoid using private macOS APIs which are not allowed on App Store (experimental)" OFF) ++ option(MACOS_BUILD_FRAMEWORKS "Build QtWebKit as framework bundles" ON) ++ ++ if (USE_APPSTORE_COMPLIANT_CODE) ++ set(MACOS_USE_SYSTEM_ICU OFF) ++ set(USE_UNIX_DOMAIN_SOCKETS ON) ++ endif () + endif () + + if (WIN32 OR APPLE) +@@ -152,7 +200,28 @@ + endif () + + # FIXME: Move Qt handling here +-find_package(Qt5Gui QUIET) ++set(REQUIRED_QT_VERSION 5.2.0) ++find_package(Qt5 ${REQUIRED_QT_VERSION} REQUIRED COMPONENTS Core Gui QUIET) ++ ++get_target_property(QT_CORE_TYPE Qt5::Core TYPE) ++if (QT_CORE_TYPE MATCHES STATIC) ++ set(QT_STATIC_BUILD ON) ++ set(SHARED_CORE OFF) ++ set(MACOS_BUILD_FRAMEWORKS OFF) ++endif () ++ ++# static icu libraries on windows are build with 's' prefix ++if (QT_STATIC_BUILD AND MSVC) ++ set(ICU_LIBRARY_PREFIX "s") ++else () ++ set(ICU_LIBRARY_PREFIX "") ++endif () ++ ++if (QT_STATIC_BUILD) ++ set(ENABLE_WEBKIT2_DEFAULT OFF) ++else () ++ set(ENABLE_WEBKIT2_DEFAULT ON) ++endif () + + if (UNIX AND TARGET Qt5::QXcbIntegrationPlugin AND NOT APPLE) + set(ENABLE_X11_TARGET_DEFAULT ON) +@@ -179,7 +248,7 @@ + WEBKIT_OPTION_DEFINE(ENABLE_PRINT_SUPPORT "Enable support for printing web pages" PUBLIC ON) + WEBKIT_OPTION_DEFINE(ENABLE_QT_GESTURE_EVENTS "Enable support for gesture events (required for mouse in WK2)" PUBLIC ON) + WEBKIT_OPTION_DEFINE(ENABLE_QT_WEBCHANNEL "Enable support for Qt WebChannel" PUBLIC ON) +-WEBKIT_OPTION_DEFINE(ENABLE_WEBKIT2 "Enable WebKit2 (QML API)" PUBLIC ON) ++WEBKIT_OPTION_DEFINE(ENABLE_WEBKIT2 "Enable WebKit2 (QML API)" PUBLIC ${ENABLE_WEBKIT2_DEFAULT}) + WEBKIT_OPTION_DEFINE(ENABLE_X11_TARGET "Whether to enable support for the X11 windowing target." PUBLIC ${ENABLE_X11_TARGET_DEFAULT}) + + option(GENERATE_DOCUMENTATION "Generate HTML and QCH documentation" OFF) +@@ -190,6 +259,7 @@ + # Private options specific to the Qt port. Changing these options is + # completely unsupported. They are intended for use only by WebKit developers. + WEBKIT_OPTION_DEFINE(ENABLE_TOUCH_ADJUSTMENT "Whether to use touch adjustment" PRIVATE ON) ++WEBKIT_OPTION_DEFINE(USE_LIBJPEG "Support JPEG format directly. If it is disabled, QImageReader will be used with possible degradation of user experience" PUBLIC ON) + + + # Public options shared with other WebKit ports. There must be strong reason +@@ -249,11 +319,17 @@ + endif () + + WEBKIT_OPTION_CONFLICT(USE_GSTREAMER USE_QT_MULTIMEDIA) ++WEBKIT_OPTION_CONFLICT(USE_GSTREAMER USE_MEDIA_FOUNDATION) ++WEBKIT_OPTION_CONFLICT(USE_QT_MULTIMEDIA USE_MEDIA_FOUNDATION) + + WEBKIT_OPTION_DEPEND(ENABLE_3D_TRANSFORMS ENABLE_OPENGL) + WEBKIT_OPTION_DEPEND(ENABLE_ACCELERATED_2D_CANVAS ENABLE_OPENGL) + WEBKIT_OPTION_DEPEND(ENABLE_WEBGL ENABLE_OPENGL) + ++# Building video without these options is not supported ++WEBKIT_OPTION_DEPEND(ENABLE_VIDEO ENABLE_VIDEO_TRACK) ++WEBKIT_OPTION_DEPEND(ENABLE_VIDEO ENABLE_MEDIA_CONTROLS_SCRIPT) ++ + # WebAudio and MediaSource are supported with GStreamer only + WEBKIT_OPTION_DEPEND(ENABLE_WEB_AUDIO USE_GSTREAMER) + WEBKIT_OPTION_DEPEND(ENABLE_LEGACY_WEB_AUDIO USE_GSTREAMER) +@@ -261,6 +337,8 @@ + + WEBKIT_OPTION_DEPEND(ENABLE_QT_WEBCHANNEL ENABLE_WEBKIT2) + ++WEBKIT_OPTION_DEPEND(ENABLE_TOUCH_ADJUSTMENT ENABLE_QT_GESTURE_EVENTS) ++ + # While it's possible to have UI-less NPAPI plugins without X11, we don't support this case yet + if (UNIX AND NOT APPLE) + WEBKIT_OPTION_DEPEND(ENABLE_NETSCAPE_PLUGIN_API ENABLE_X11_TARGET) +@@ -271,9 +349,9 @@ + # FTL JIT and IndexedDB support require GCC 4.9 + # TODO: Patch code to avoid variadic lambdas + if (CMAKE_CXX_COMPILER_ID STREQUAL "GNU") +- if (ENABLE_FTL_JIT OR ENABLE_INDEXED_DATABASE) ++ if (ENABLE_FTL_JIT OR ENABLE_INDEXED_DATABASE OR (ENABLE_WEBKIT2 AND ENABLE_DATABASE_PROCESS)) + if (CMAKE_CXX_COMPILER_VERSION VERSION_LESS "4.9.0") +- message(FATAL_ERROR "GCC 4.9.0 is required to build QtWebKit with FTL JIT and Indexed Database, use a newer GCC version or clang, or disable these features") ++ message(FATAL_ERROR "GCC 4.9.0 is required to build QtWebKit with FTL JIT, Indexed Database, and Database Process (WebKit 2). Use a newer GCC version or clang, or disable these features") + endif () + else () + if (CMAKE_CXX_COMPILER_VERSION VERSION_LESS "4.8.0") +@@ -291,13 +369,6 @@ + set(ENABLE_WEBKIT ON) + set(WTF_USE_UDIS86 1) + +-get_target_property(QT_CORE_TYPE Qt5::Core TYPE) +-if (QT_CORE_TYPE MATCHES STATIC) +- set(QT_STATIC_BUILD ON) +- set(SHARED_CORE OFF) +- set(MACOS_BUILD_FRAMEWORKS OFF) +-endif () +- + if (SHARED_CORE) + set(WebCoreTestSupport_LIBRARY_TYPE SHARED) + else () +@@ -360,6 +431,7 @@ + add_library(qtsqlite STATIC ${SQLITE_SOURCE_FILE}) + target_compile_definitions(qtsqlite PUBLIC -DSQLITE_CORE -DSQLITE_OMIT_LOAD_EXTENSION -DSQLITE_OMIT_COMPLETE) + WEBKIT_SET_EXTRA_COMPILER_FLAGS(qtsqlite) ++ QT_ADD_EXTRA_WEBKIT_TARGET_EXPORT(qtsqlite) + set(SQLITE_LIBRARIES qtsqlite) + set(SQLITE_FOUND 1) + else () +@@ -368,10 +440,13 @@ + + find_package(Threads REQUIRED) + +-if (NOT QT_BUNDLED_JPEG) +- find_package(JPEG REQUIRED) ++if (USE_LIBJPEG) ++ find_package(JPEG) ++ if (NOT JPEG_FOUND) ++ message(FATAL_ERROR "libjpeg not found. Please make sure that CMake can find its header files and libraries, or build with -DUSE_LIBJPEG=OFF with possible degradation of user experience") ++ endif () + else () +- set(JPEG_FOUND 1) ++ message(WARNING "USE_LIBJPEG is disabled, will attempt using QImageReader to decode JPEG with possible degradation of user experience") + endif () + + if (NOT QT_BUNDLED_PNG) +@@ -386,15 +461,19 @@ + set(ZLIB_FOUND 1) + endif () + +-if (NOT APPLE) +- find_package(ICU REQUIRED) +-else () ++if (MACOS_USE_SYSTEM_ICU) ++ # Use system ICU library and bundled headers + set(ICU_INCLUDE_DIRS + "${WEBCORE_DIR}/icu" + "${JAVASCRIPTCORE_DIR}/icu" + "${WTF_DIR}/icu" + ) + set(ICU_LIBRARIES libicucore.dylib) ++else () ++ find_package(ICU REQUIRED) ++endif () ++ ++if (APPLE) + find_library(COREFOUNDATION_LIBRARY CoreFoundation) + if (QT_STATIC_BUILD) + find_library(CARBON_LIBRARY Carbon) +@@ -419,10 +498,11 @@ + endif () + endif () + +-find_package(Fontconfig) +- +-if (FONTCONFIG_FOUND) +- SET_AND_EXPOSE_TO_BUILD(HAVE_FONTCONFIG 1) ++if (ENABLE_TEST_SUPPORT) ++ find_package(Fontconfig) ++ if (FONTCONFIG_FOUND) ++ SET_AND_EXPOSE_TO_BUILD(HAVE_FONTCONFIG 1) ++ endif () + endif () + + find_package(WebP) +@@ -431,7 +511,6 @@ + SET_AND_EXPOSE_TO_BUILD(USE_WEBP 1) + endif () + +-set(REQUIRED_QT_VERSION 5.2.0) + set(QT_REQUIRED_COMPONENTS Core Gui Network) + + # FIXME: Allow building w/o these components +@@ -461,6 +540,33 @@ + SET_AND_EXPOSE_TO_BUILD(HAVE_QTSENSORS 1) + endif () + ++if (ENABLE_OPENGL) ++ # Note: Gui module is already found ++ # Warning: quotes are sinificant here! ++ if (NOT DEFINED Qt5Gui_OPENGL_IMPLEMENTATION OR "${Qt5Gui_OPENGL_IMPLEMENTATION}" STREQUAL "") ++ message(FATAL_ERROR "Qt with OpenGL support is required for ENABLE_OPENGL") ++ endif () ++ ++ SET_AND_EXPOSE_TO_BUILD(USE_TEXTURE_MAPPER_GL TRUE) ++ SET_AND_EXPOSE_TO_BUILD(ENABLE_GRAPHICS_CONTEXT_3D TRUE) ++ ++ if (WIN32) ++ include(CheckCXXSymbolExists) ++ set(CMAKE_REQUIRED_INCLUDES ${Qt5Gui_INCLUDE_DIRS}) ++ set(CMAKE_REQUIRED_FLAGS ${Qt5Gui_EXECUTABLE_COMPILE_FLAGS}) ++ check_cxx_symbol_exists(QT_OPENGL_DYNAMIC qopenglcontext.h HAVE_QT_OPENGL_DYNAMIC) ++ if (HAVE_QT_OPENGL_DYNAMIC) ++ set(Qt5Gui_OPENGL_IMPLEMENTATION DynamicGL) ++ endif () ++ unset(CMAKE_REQUIRED_INCLUDES) ++ unset(CMAKE_REQUIRED_FLAGS) ++ endif () ++ ++ message(STATUS "Qt OpenGL implementation: ${Qt5Gui_OPENGL_IMPLEMENTATION}") ++ message(STATUS "Qt OpenGL libraries: ${Qt5Gui_OPENGL_LIBRARIES}") ++ message(STATUS "Qt EGL libraries: ${Qt5Gui_EGL_LIBRARIES}") ++endif () ++ + if (ENABLE_PRINT_SUPPORT) + list(APPEND QT_REQUIRED_COMPONENTS PrintSupport) + SET_AND_EXPOSE_TO_BUILD(HAVE_QTPRINTSUPPORT 1) +@@ -480,7 +586,7 @@ + + # Mach ports and Unix sockets are currently used by WK2, but their USE() values + # affect building WorkQueue +-if (APPLE) ++if (APPLE AND NOT USE_UNIX_DOMAIN_SOCKETS) + SET_AND_EXPOSE_TO_BUILD(USE_MACH_PORTS 1) # Qt-specific + elseif (UNIX) + SET_AND_EXPOSE_TO_BUILD(USE_UNIX_DOMAIN_SOCKETS 1) +@@ -493,6 +599,12 @@ + endif () + + find_package(Qt5 ${REQUIRED_QT_VERSION} REQUIRED COMPONENTS ${QT_REQUIRED_COMPONENTS}) ++ ++CHECK_QT5_PRIVATE_INCLUDE_DIRS(Gui private/qhexstring_p.h) ++if (ENABLE_WEBKIT2) ++ CHECK_QT5_PRIVATE_INCLUDE_DIRS(Quick private/qsgrendernode_p.h) ++endif () ++ + if (QT_STATIC_BUILD) + foreach (qt_module ${QT_REQUIRED_COMPONENTS}) + CONVERT_PRL_LIBS_TO_CMAKE(${qt_module}) +@@ -549,6 +661,14 @@ + endif () + endif () + ++# Improvised backport of r222112 - not needed with current WebKit ++# -Wexpansion-to-defined produces false positives with GCC but not Clang ++# https://bugs.webkit.org/show_bug.cgi?id=167643#c13 ++if (CMAKE_COMPILER_IS_GNUCXX AND (NOT CMAKE_CXX_COMPILER_VERSION VERSION_LESS "7.0.0")) ++ set(CMAKE_C_FLAGS "${CMAKE_C_FLAGS} -Wno-expansion-to-defined") ++ set(CMAKE_CXX_FLAGS "${CMAKE_CXX_FLAGS} -Wno-expansion-to-defined") ++endif () ++ + if (WIN32 AND COMPILER_IS_GCC_OR_CLANG) + set(CMAKE_CXX_FLAGS "${CMAKE_CXX_FLAGS} -fno-keep-inline-dllexport") + endif () +@@ -597,22 +717,8 @@ + endif () + endif () + +-if (ENABLE_OPENGL) +- SET_AND_EXPOSE_TO_BUILD(USE_TEXTURE_MAPPER_GL TRUE) +- SET_AND_EXPOSE_TO_BUILD(ENABLE_GRAPHICS_CONTEXT_3D TRUE) +- +- # TODO: Add proper support of DynamicGL detection to Qt and use it +- if (WIN32) +- if (QT_USES_GLES2_ONLY) +- # FIXME: Fix build with ANGLE-only Qt +- message(FATAL_ERROR "Only dynamic GL is supported on Windows at the moment") +- else () +- set(Qt5Gui_OPENGL_IMPLEMENTATION GL) +- endif () +- endif () +-endif () +- + if (NOT ENABLE_VIDEO) ++ set(USE_MEDIA_FOUNDATION OFF) + set(USE_QT_MULTIMEDIA OFF) + + if (NOT ENABLE_WEB_AUDIO) +@@ -678,6 +784,15 @@ + endif () + endif () + ++if (USE_WOFF2) ++ find_package(WOFF2Dec 1.0.1) ++ if (WOFF2DEC_FOUND) ++ message(STATUS "Using system WOFF2Dec library.") ++ else () ++ message(STATUS "WOFF2Dec not found, using the bundled library.") ++ endif () ++endif () ++ + # From OptionsGTK.cmake + if (CMAKE_MAJOR_VERSION LESS 3) + # Before CMake 3 it was necessary to use a build script instead of using cmake --build directly +@@ -800,7 +915,7 @@ + endif () + + if (NOT QT_CONAN_DIR) +- set(ICU_LIBRARIES icuuc${CMAKE_DEBUG_POSTFIX} icuin${CMAKE_DEBUG_POSTFIX} icudt${CMAKE_DEBUG_POSTFIX}) ++ set(ICU_LIBRARIES ${ICU_LIBRARY_PREFIX}icuuc${CMAKE_DEBUG_POSTFIX} ${ICU_LIBRARY_PREFIX}icuin${CMAKE_DEBUG_POSTFIX} ${ICU_LIBRARY_PREFIX}icudt${CMAKE_DEBUG_POSTFIX}) + endif () + endif () + +diff -Nuar a/Source/cmake/OptionsWin.cmake b/Source/cmake/OptionsWin.cmake +--- a/Source/cmake/OptionsWin.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/OptionsWin.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -128,6 +128,9 @@ + /wd6255 /wd6387 + ) + ++ # Eliminate C2139 errors ++ add_compile_options(/D_ENABLE_EXTENDED_ALIGNED_STORAGE) ++ + # Create pdb files for debugging purposes, also for Release builds + add_compile_options(/Zi /GS) + +diff -Nuar a/Source/cmake/WebKitCommon.cmake b/Source/cmake/WebKitCommon.cmake +--- a/Source/cmake/WebKitCommon.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/WebKitCommon.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -25,6 +25,9 @@ + find_package(Perl 5.10.0 REQUIRED) + + find_package(PythonInterp 2.7.0 REQUIRED) ++ if (PYTHON_VERSION_MAJOR GREATER 2) ++ message(FATAL_ERROR "Python 2 is required, but Python ${PYTHON_VERSION_MAJOR} was found.") ++ endif () + + # We cannot check for RUBY_FOUND because it is set only when the full package is installed and + # the only thing we need is the interpreter. Unlike Python, cmake does not provide a macro +@@ -38,6 +41,9 @@ + # Helper macros and feature defines + # ----------------------------------------------------------------------------- + ++ # To prevent multiple inclusion, most modules should be included once here. ++ include(CheckFunctionExists) ++ + include(WebKitMacros) + include(WebKitFS) + include(WebKitHelpers) +diff -Nuar a/Source/cmake/WebKitFeatures.cmake b/Source/cmake/WebKitFeatures.cmake +--- a/Source/cmake/WebKitFeatures.cmake 2017-06-04 23:16:07.000000000 +0300 ++++ b/Source/cmake/WebKitFeatures.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -101,7 +101,7 @@ + WEBKIT_OPTION_DEFINE(ENABLE_DFG_JIT "Toggle data flow graph JIT tier" PRIVATE ON) + WEBKIT_OPTION_DEFINE(ENABLE_DOM4_EVENTS_CONSTRUCTOR "Toggle DOM4 Events constructors" PRIVATE OFF) + WEBKIT_OPTION_DEFINE(ENABLE_DOWNLOAD_ATTRIBUTE "Toggle download attribute support" PRIVATE OFF) +- WEBKIT_OPTION_DEFINE(ENABLE_DRAG_SUPPORT "Toggle Drag Support" PRIVATE OFF) ++ WEBKIT_OPTION_DEFINE(ENABLE_DRAG_SUPPORT "Toggle support of drag actions (including selection of text with mouse)" PRIVATE OFF) + WEBKIT_OPTION_DEFINE(ENABLE_ENCRYPTED_MEDIA "Toggle EME support" PRIVATE OFF) + WEBKIT_OPTION_DEFINE(ENABLE_ENCRYPTED_MEDIA_V2 "Support EME v2" PRIVATE OFF) + WEBKIT_OPTION_DEFINE(ENABLE_ES6_ARROWFUNCTION_SYNTAX "Toggle ES6 arrow function syntax support" PRIVATE ON) +diff -Nuar a/Source/cmake/WebKitMacros.cmake b/Source/cmake/WebKitMacros.cmake +--- a/Source/cmake/WebKitMacros.cmake 2017-06-16 02:36:48.000000000 +0300 ++++ b/Source/cmake/WebKitMacros.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -373,26 +373,20 @@ + WORKING_DIRECTORY ${WEBKIT2_DIR} + VERBATIM) + ++ if (${PORT} STREQUAL "Qt") ++ set_property(SOURCE ${DERIVED_SOURCES_WEBKIT2_DIR}/${_name}MessageReceiver.cpp PROPERTY SKIP_AUTOMOC ON) ++ endif () ++ + list(APPEND ${_output_source} ${DERIVED_SOURCES_WEBKIT2_DIR}/${_name}MessageReceiver.cpp) + endforeach () + endmacro() + +-macro(MAKE_JS_FILE_ARRAYS _output_cpp _output_h _scripts _scripts_dependencies) +- if (NOT CMAKE_VERSION VERSION_LESS 3.1) +- set(_python_path ${CMAKE_COMMAND} -E env "PYTHONPATH=${JavaScriptCore_SCRIPTS_DIR}") +- elseif (WIN32) +- set(_python_path set "PYTHONPATH=${JavaScriptCore_SCRIPTS_DIR}" &&) +- else () +- set(_python_path "PYTHONPATH=${JavaScriptCore_SCRIPTS_DIR}") +- endif () +- ++macro(MAKE_JS_FILE_ARRAYS _output_cpp _output_h _namespace _scripts _scripts_dependencies) + add_custom_command( + OUTPUT ${_output_h} ${_output_cpp} +- MAIN_DEPENDENCY ${WEBCORE_DIR}/Scripts/make-js-file-arrays.py +- DEPENDS ${${_scripts}} +- COMMAND ${_python_path} ${PYTHON_EXECUTABLE} ${WEBCORE_DIR}/Scripts/make-js-file-arrays.py ${_output_h} ${_output_cpp} ${${_scripts}} ++ DEPENDS ${JavaScriptCore_SCRIPTS_DIR}/make-js-file-arrays.py ${${_scripts}} ++ COMMAND ${PYTHON_EXECUTABLE} ${JavaScriptCore_SCRIPTS_DIR}/make-js-file-arrays.py -n ${_namespace} ${_output_h} ${_output_cpp} ${${_scripts}} + VERBATIM) +- list(APPEND WebCore_DERIVED_SOURCES ${_output_cpp}) + ADD_SOURCE_DEPENDENCIES(${${_scripts_dependencies}} ${_output_h} ${_output_cpp}) + endmacro() + +diff -Nuar a/Source/CMakeLists.txt b/Source/CMakeLists.txt +--- a/Source/CMakeLists.txt 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/CMakeLists.txt 2019-06-10 00:48:46.000000000 +0300 +@@ -19,7 +19,7 @@ + add_subdirectory(ThirdParty/gtest) + endif () + +-if (USE_WOFF2) ++if (USE_WOFF2 AND NOT WOFF2DEC_FOUND) + add_subdirectory(ThirdParty/brotli) + add_subdirectory(ThirdParty/woff2) + endif () +diff -Nuar a/Source/JavaScriptCore/assembler/AbstractMacroAssembler.h b/Source/JavaScriptCore/assembler/AbstractMacroAssembler.h +--- a/Source/JavaScriptCore/assembler/AbstractMacroAssembler.h 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/assembler/AbstractMacroAssembler.h 2019-06-10 00:48:46.000000000 +0300 +@@ -58,6 +58,15 @@ + #endif + } + ++inline bool isMIPS() ++{ ++#if CPU(MIPS) ++ return true; ++#else ++ return false; ++#endif ++} ++ + inline bool isX86() + { + #if CPU(X86_64) || CPU(X86) +@@ -86,6 +95,11 @@ + return isARM64() && Options::useArchitectureSpecificOptimizations(); + } + ++inline bool optimizeForMIPS() ++{ ++ return isMIPS() && Options::useArchitectureSpecificOptimizations(); ++} ++ + inline bool optimizeForX86() + { + return isX86() && Options::useArchitectureSpecificOptimizations(); +diff -Nuar a/Source/JavaScriptCore/assembler/MacroAssemblerMIPS.h b/Source/JavaScriptCore/assembler/MacroAssemblerMIPS.h +--- a/Source/JavaScriptCore/assembler/MacroAssemblerMIPS.h 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/assembler/MacroAssemblerMIPS.h 2019-06-10 00:48:46.000000000 +0300 +@@ -816,7 +816,53 @@ + + void load16Unaligned(BaseIndex address, RegisterID dest) + { +- load16(address, dest); ++ if (address.offset >= -32768 && address.offset <= 32767 && !m_fixedWidth) { ++ /* ++ sll addrtemp, address.index, address.scale ++ addu addrtemp, addrtemp, address.base ++ lbu immTemp, address.offset+x(addrtemp) (x=0 for LE, x=1 for BE) ++ lbu dest, address.offset+x(addrtemp) (x=1 for LE, x=0 for BE) ++ sll dest, dest, 8 ++ or dest, dest, immTemp ++ */ ++ m_assembler.sll(addrTempRegister, address.index, address.scale); ++ m_assembler.addu(addrTempRegister, addrTempRegister, address.base); ++#if CPU(BIG_ENDIAN) ++ m_assembler.lbu(immTempRegister, addrTempRegister, address.offset + 1); ++ m_assembler.lbu(dest, addrTempRegister, address.offset); ++#else ++ m_assembler.lbu(immTempRegister, addrTempRegister, address.offset); ++ m_assembler.lbu(dest, addrTempRegister, address.offset + 1); ++#endif ++ m_assembler.sll(dest, dest, 8); ++ m_assembler.orInsn(dest, dest, immTempRegister); ++ } else { ++ /* ++ sll addrTemp, address.index, address.scale ++ addu addrTemp, addrTemp, address.base ++ lui immTemp, address.offset >> 16 ++ ori immTemp, immTemp, address.offset & 0xffff ++ addu addrTemp, addrTemp, immTemp ++ lbu immTemp, x(addrtemp) (x=0 for LE, x=1 for BE) ++ lbu dest, x(addrtemp) (x=1 for LE, x=0 for BE) ++ sll dest, dest, 8 ++ or dest, dest, immTemp ++ */ ++ m_assembler.sll(addrTempRegister, address.index, address.scale); ++ m_assembler.addu(addrTempRegister, addrTempRegister, address.base); ++ m_assembler.lui(immTempRegister, address.offset >> 16); ++ m_assembler.ori(immTempRegister, immTempRegister, address.offset); ++ m_assembler.addu(addrTempRegister, addrTempRegister, immTempRegister); ++#if CPU(BIG_ENDIAN) ++ m_assembler.lbu(immTempRegister, addrTempRegister, 1); ++ m_assembler.lbu(dest, addrTempRegister, 0); ++#else ++ m_assembler.lbu(immTempRegister, addrTempRegister, 0); ++ m_assembler.lbu(dest, addrTempRegister, 1); ++#endif ++ m_assembler.sll(dest, dest, 8); ++ m_assembler.orInsn(dest, dest, immTempRegister); ++ } + } + + void load32WithUnalignedHalfWords(BaseIndex address, RegisterID dest) +@@ -2645,8 +2691,6 @@ + + Jump branchEqual(RegisterID rs, RegisterID rt) + { +- m_assembler.nop(); +- m_assembler.nop(); + m_assembler.appendJump(); + m_assembler.beq(rs, rt, 0); + m_assembler.nop(); +@@ -2656,8 +2700,6 @@ + + Jump branchNotEqual(RegisterID rs, RegisterID rt) + { +- m_assembler.nop(); +- m_assembler.nop(); + m_assembler.appendJump(); + m_assembler.bne(rs, rt, 0); + m_assembler.nop(); +diff -Nuar a/Source/JavaScriptCore/assembler/MIPSAssembler.h b/Source/JavaScriptCore/assembler/MIPSAssembler.h +--- a/Source/JavaScriptCore/assembler/MIPSAssembler.h 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/assembler/MIPSAssembler.h 2019-06-10 00:48:46.000000000 +0300 +@@ -733,35 +733,6 @@ + // writable region of memory; to modify the code in an execute-only execuable + // pool the 'repatch' and 'relink' methods should be used. + +- static size_t linkDirectJump(void* code, void* to) +- { +- MIPSWord* insn = reinterpret_cast(reinterpret_cast(code)); +- size_t ops = 0; +- int32_t slotAddr = reinterpret_cast(insn) + 4; +- int32_t toAddr = reinterpret_cast(to); +- +- if ((slotAddr & 0xf0000000) != (toAddr & 0xf0000000)) { +- // lui +- *insn = 0x3c000000 | (MIPSRegisters::t9 << OP_SH_RT) | ((toAddr >> 16) & 0xffff); +- ++insn; +- // ori +- *insn = 0x34000000 | (MIPSRegisters::t9 << OP_SH_RT) | (MIPSRegisters::t9 << OP_SH_RS) | (toAddr & 0xffff); +- ++insn; +- // jr +- *insn = 0x00000008 | (MIPSRegisters::t9 << OP_SH_RS); +- ++insn; +- ops = 4 * sizeof(MIPSWord); +- } else { +- // j +- *insn = 0x08000000 | ((toAddr & 0x0fffffff) >> 2); +- ++insn; +- ops = 2 * sizeof(MIPSWord); +- } +- // nop +- *insn = 0x00000000; +- return ops; +- } +- + void linkJump(AssemblerLabel from, AssemblerLabel to) + { + ASSERT(to.isSet()); +@@ -881,34 +852,42 @@ + + static ptrdiff_t maxJumpReplacementSize() + { +- return sizeof(MIPSWord) * 4; ++ return sizeof(MIPSWord) * 2; + } + + static void revertJumpToMove(void* instructionStart, RegisterID rt, int imm) + { + MIPSWord* insn = static_cast(instructionStart); +- size_t codeSize = 2 * sizeof(MIPSWord); + + // lui + *insn = 0x3c000000 | (rt << OP_SH_RT) | ((imm >> 16) & 0xffff); + ++insn; + // ori + *insn = 0x34000000 | (rt << OP_SH_RS) | (rt << OP_SH_RT) | (imm & 0xffff); +- ++insn; +- // if jr $t9 +- if (*insn == 0x03200008) { +- *insn = 0x00000000; +- codeSize += sizeof(MIPSWord); +- } +- cacheFlush(insn, codeSize); ++ cacheFlush(insn, 2 * sizeof(MIPSWord)); ++ } ++ ++ static bool canJumpWithJ(void* instructionStart, void* to) ++ { ++ intptr_t slotAddr = reinterpret_cast(instructionStart) + 4; ++ intptr_t toAddr = reinterpret_cast(to); ++ return (slotAddr & 0xf0000000) == (toAddr & 0xf0000000); + } + + static void replaceWithJump(void* instructionStart, void* to) + { + ASSERT(!(bitwise_cast(instructionStart) & 3)); + ASSERT(!(bitwise_cast(to) & 3)); +- size_t ops = linkDirectJump(instructionStart, to); +- cacheFlush(instructionStart, ops); ++ ASSERT(canJumpWithJ(instructionStart, to)); ++ MIPSWord* insn = reinterpret_cast(instructionStart); ++ int32_t toAddr = reinterpret_cast(to); ++ ++ // j ++ *insn = 0x08000000 | ((toAddr & 0x0fffffff) >> 2); ++ ++insn; ++ // nop ++ *insn = 0x00000000; ++ cacheFlush(instructionStart, 2 * sizeof(MIPSWord)); + } + + static void replaceWithLoad(void* instructionStart) +diff -Nuar a/Source/JavaScriptCore/bytecode/Opcode.cpp b/Source/JavaScriptCore/bytecode/Opcode.cpp +--- a/Source/JavaScriptCore/bytecode/Opcode.cpp 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/bytecode/Opcode.cpp 2019-06-10 00:48:46.000000000 +0300 +@@ -49,6 +49,18 @@ + + #if ENABLE(OPCODE_STATS) + ++inline const char* padOpcodeName(OpcodeID op, unsigned width) ++{ ++ auto padding = " "; ++ auto paddingLength = strlen(padding); ++ auto opcodeNameLength = strlen(opcodeNames[op]); ++ if (opcodeNameLength >= width) ++ return ""; ++ if (paddingLength + opcodeNameLength < width) ++ return padding; ++ return &padding[paddingLength + opcodeNameLength - width]; ++} ++ + long long OpcodeStats::opcodeCounts[numOpcodeIDs]; + long long OpcodeStats::opcodePairCounts[numOpcodeIDs][numOpcodeIDs]; + int OpcodeStats::lastOpcode = -1; +@@ -80,9 +92,9 @@ + + static int compareOpcodePairIndices(const void* left, const void* right) + { +- std::pair leftPair = *(pair*) left; ++ std::pair leftPair = *(std::pair*) left; + long long leftValue = OpcodeStats::opcodePairCounts[leftPair.first][leftPair.second]; +- std::pair rightPair = *(pair*) right; ++ std::pair rightPair = *(std::pair*) right; + long long rightValue = OpcodeStats::opcodePairCounts[rightPair.first][rightPair.second]; + + if (leftValue < rightValue) +diff -Nuar a/Source/JavaScriptCore/bytecode/Opcode.h b/Source/JavaScriptCore/bytecode/Opcode.h +--- a/Source/JavaScriptCore/bytecode/Opcode.h 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/bytecode/Opcode.h 2019-06-10 00:48:46.000000000 +0300 +@@ -85,21 +85,8 @@ + typedef OpcodeID Opcode; + #endif + +-#define PADDING_STRING " " +-#define PADDING_STRING_LENGTH static_cast(strlen(PADDING_STRING)) +- + extern const char* const opcodeNames[]; + +-inline const char* padOpcodeName(OpcodeID op, unsigned width) +-{ +- unsigned pad = width - strlen(opcodeNames[op]); +- pad = std::min(pad, PADDING_STRING_LENGTH); +- return PADDING_STRING + PADDING_STRING_LENGTH - pad; +-} +- +-#undef PADDING_STRING_LENGTH +-#undef PADDING_STRING +- + #if ENABLE(OPCODE_STATS) + + struct OpcodeStats { +diff -Nuar a/Source/JavaScriptCore/CMakeLists.txt b/Source/JavaScriptCore/CMakeLists.txt +--- a/Source/JavaScriptCore/CMakeLists.txt 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/CMakeLists.txt 2019-06-10 00:48:46.000000000 +0300 +@@ -388,7 +388,6 @@ + + disassembler/udis86/udis86.c + disassembler/udis86/udis86_decode.c +- disassembler/udis86/udis86_input.c + disassembler/udis86/udis86_itab_holder.c + disassembler/udis86/udis86_syn-att.c + disassembler/udis86/udis86_syn-intel.c +@@ -909,14 +908,13 @@ + + set(UDIS_GEN_DEP + disassembler/udis86/ud_opcode.py +- disassembler/udis86/ud_optable.py + ) + + add_custom_command( + OUTPUT ${DERIVED_SOURCES_JAVASCRIPTCORE_DIR}/udis86_itab.c ${DERIVED_SOURCES_JAVASCRIPTCORE_DIR}/udis86_itab.h + DEPENDS ${UDIS_GEN_DEP} + WORKING_DIRECTORY ${DERIVED_SOURCES_JAVASCRIPTCORE_DIR} +- COMMAND ${PYTHON_EXECUTABLE} ${JAVASCRIPTCORE_DIR}/disassembler/udis86/itab.py ${JAVASCRIPTCORE_DIR}/disassembler/udis86/optable.xml ++ COMMAND ${PYTHON_EXECUTABLE} ${JAVASCRIPTCORE_DIR}/disassembler/udis86/ud_itab.py ${JAVASCRIPTCORE_DIR}/disassembler/udis86/optable.xml ${DERIVED_SOURCES_JAVASCRIPTCORE_DIR} + VERBATIM) + + list(APPEND JavaScriptCore_HEADERS +@@ -1279,6 +1277,7 @@ + + if (WTF_CPU_ARM) + elseif (WTF_CPU_ARM64) ++elseif (WTF_CPU_ALPHA) + elseif (WTF_CPU_HPPA) + elseif (WTF_CPU_PPC) + elseif (WTF_CPU_PPC64) +diff -Nuar a/Source/JavaScriptCore/DerivedSources.make b/Source/JavaScriptCore/DerivedSources.make +--- a/Source/JavaScriptCore/DerivedSources.make 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/DerivedSources.make 2019-06-10 00:48:46.000000000 +0300 +@@ -171,8 +171,8 @@ + + # udis86 instruction tables + +-udis86_itab.h: $(JavaScriptCore)/disassembler/udis86/itab.py $(JavaScriptCore)/disassembler/udis86/optable.xml +- $(PYTHON) $(JavaScriptCore)/disassembler/udis86/itab.py $(JavaScriptCore)/disassembler/udis86/optable.xml ++udis86_itab.h: $(JavaScriptCore)/disassembler/udis86/ud_itab.py $(JavaScriptCore)/disassembler/udis86/optable.xml ++ $(PYTHON) $(JavaScriptCore)/disassembler/udis86/ud_itab.py $(JavaScriptCore)/disassembler/udis86/optable.xml . + + # Bytecode files + +diff -Nuar a/Source/JavaScriptCore/dfg/DFGFixupPhase.cpp b/Source/JavaScriptCore/dfg/DFGFixupPhase.cpp +--- a/Source/JavaScriptCore/dfg/DFGFixupPhase.cpp 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/dfg/DFGFixupPhase.cpp 2019-06-10 00:48:46.000000000 +0300 +@@ -282,7 +282,7 @@ + break; + } + if (m_graph.binaryArithShouldSpeculateInt32(node, FixupPass)) { +- if (optimizeForX86() || optimizeForARM64() || optimizeForARMv7IDIVSupported()) { ++ if (optimizeForX86() || optimizeForARM64() || optimizeForARMv7IDIVSupported() || optimizeForMIPS()) { + fixIntOrBooleanEdge(leftChild); + fixIntOrBooleanEdge(rightChild); + if (bytecodeCanTruncateInteger(node->arithNodeFlags())) +diff -Nuar a/Source/JavaScriptCore/dfg/DFGSpeculativeJIT.cpp b/Source/JavaScriptCore/dfg/DFGSpeculativeJIT.cpp +--- a/Source/JavaScriptCore/dfg/DFGSpeculativeJIT.cpp 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/dfg/DFGSpeculativeJIT.cpp 2019-06-10 00:48:46.000000000 +0300 +@@ -4014,6 +4014,46 @@ + } + + int32Result(quotient.gpr(), node); ++#elif CPU(MIPS) ++ SpeculateInt32Operand op1(this, node->child1()); ++ SpeculateInt32Operand op2(this, node->child2()); ++ GPRTemporary quotient(this); ++ GPRReg op1GPR = op1.gpr(); ++ GPRReg op2GPR = op2.gpr(); ++ GPRReg quotientGPR = quotient.gpr(); ++ JITCompiler::Jump done; ++ ++ // If the user cares about negative zero, then speculate that we're not about ++ // to produce negative zero. ++ if (!bytecodeCanIgnoreNegativeZero(node->arithNodeFlags())) { ++ MacroAssembler::Jump numeratorNonZero = m_jit.branchTest32(MacroAssembler::NonZero, op1GPR); ++ speculationCheck(NegativeZero, JSValueRegs(), 0, m_jit.branch32(MacroAssembler::LessThan, op2GPR, TrustedImm32(0))); ++ numeratorNonZero.link(&m_jit); ++ } ++ ++ if (bytecodeUsesAsNumber(node->arithNodeFlags())) { ++ speculationCheck(Overflow, JSValueRegs(), 0, m_jit.branchTest32(JITCompiler::Zero, op2GPR)); ++ speculationCheck(Overflow, JSValueRegs(), 0, m_jit.branch32(JITCompiler::Equal, op1GPR, TrustedImm32(-2147483647-1))); ++ } else { ++ JITCompiler::Jump notZero = m_jit.branchTest32(JITCompiler::NonZero, op2GPR); ++ m_jit.move(TrustedImm32(0), quotientGPR); ++ done = m_jit.jump(); ++ notZero.link(&m_jit); ++ } ++ ++ m_jit.assembler().div(op1GPR, op2GPR); ++ m_jit.assembler().mflo(quotientGPR); ++ ++ // Check that there was no remainder. If there had been, then we'd be obligated to ++ // produce a double result instead. ++ if (bytecodeUsesAsNumber(node->arithNodeFlags())) { ++ GPRTemporary remainder(this); ++ m_jit.assembler().mfhi(remainder.gpr()); ++ speculationCheck(Overflow, JSValueRegs(), 0, m_jit.branchTest32(MacroAssembler::NonZero, remainder.gpr())); ++ } else ++ done.link(&m_jit); ++ ++ int32Result(quotientGPR, node); + #else + RELEASE_ASSERT_NOT_REACHED(); + #endif +@@ -4394,6 +4434,24 @@ + done.link(&m_jit); + + int32Result(quotientThenRemainderGPR, node); ++#elif CPU(MIPS) ++ GPRTemporary remainder(this); ++ GPRReg dividendGPR = op1.gpr(); ++ GPRReg divisorGPR = op2.gpr(); ++ GPRReg remainderGPR = remainder.gpr(); ++ ++ speculationCheck(Overflow, JSValueRegs(), 0, m_jit.branch32(JITCompiler::Equal, dividendGPR, TrustedImm32(-2147483647-1))); ++ m_jit.assembler().div(dividendGPR, divisorGPR); ++ m_jit.assembler().mfhi(remainderGPR); ++ ++ if (!bytecodeCanIgnoreNegativeZero(node->arithNodeFlags())) { ++ // Check that we're not about to create negative zero. ++ JITCompiler::Jump numeratorPositive = m_jit.branch32(JITCompiler::GreaterThanOrEqual, dividendGPR, TrustedImm32(0)); ++ speculationCheck(NegativeZero, JSValueRegs(), 0, m_jit.branchTest32(JITCompiler::Zero, remainderGPR)); ++ numeratorPositive.link(&m_jit); ++ } ++ ++ int32Result(remainderGPR, node); + #else // not architecture that can do integer division + RELEASE_ASSERT_NOT_REACHED(); + #endif +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/differences.txt b/Source/JavaScriptCore/disassembler/udis86/differences.txt +--- a/Source/JavaScriptCore/disassembler/udis86/differences.txt 2016-05-21 18:54:11.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/differences.txt 2019-06-10 00:48:46.000000000 +0300 +@@ -5,20 +5,5 @@ + + - assert() has been changed to ASSERT() + +-- Mass rename of udis86_input.h inp_ prefixed functions and macros to ud_inp_ to +- avoid namespace pollution. +- +-- Removal of KERNEL checks. +- +-- Added #include of udis86_extern.h in udis86_decode.c. +- +-- Removed s_ie__pause and s_ie__nop from udis86_decode.c, since they weren't used. +- +-- Made udis86_syn.h use WTF_ATTRIBUTE_PRINTF. This required making a bunch of little +- fixes to make the compiler's format string warnings go away. +- +-- Made the code in udis86_syn.h use vsnprintf() instead of vsprintf(). +- + - Fixed udis86_syn-att.c's jump destination printing to work correctly in 64-bit mode. + +-- Add --outputDir option to itab.py. +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/itab.py b/Source/JavaScriptCore/disassembler/udis86/itab.py +--- a/Source/JavaScriptCore/disassembler/udis86/itab.py 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/itab.py 1970-01-01 02:00:00.000000000 +0200 +@@ -1,360 +0,0 @@ +-# udis86 - scripts/itab.py +-# +-# Copyright (c) 2009 Vivek Thampi +-# All rights reserved. +-# +-# Redistribution and use in source and binary forms, with or without modification, +-# are permitted provided that the following conditions are met: +-# +-# * Redistributions of source code must retain the above copyright notice, +-# this list of conditions and the following disclaimer. +-# * Redistributions in binary form must reproduce the above copyright notice, +-# this list of conditions and the following disclaimer in the documentation +-# and/or other materials provided with the distribution. +-# +-# THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND +-# ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED +-# WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE +-# DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR +-# ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES +-# (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; +-# LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON +-# ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +-# (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS +-# SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +- +-from optparse import OptionParser +-import os +-import sys +- +-sys.path.append( '../scripts' ); +- +-import ud_optable +-import ud_opcode +- +-class UdItabGenerator( ud_opcode.UdOpcodeTables ): +- +- OperandDict = { +- "Ap" : [ "OP_A" , "SZ_P" ], +- "E" : [ "OP_E" , "SZ_NA" ], +- "Eb" : [ "OP_E" , "SZ_B" ], +- "Ew" : [ "OP_E" , "SZ_W" ], +- "Ev" : [ "OP_E" , "SZ_V" ], +- "Ed" : [ "OP_E" , "SZ_D" ], +- "Eq" : [ "OP_E" , "SZ_Q" ], +- "Ez" : [ "OP_E" , "SZ_Z" ], +- "Ex" : [ "OP_E" , "SZ_MDQ" ], +- "Ep" : [ "OP_E" , "SZ_P" ], +- "G" : [ "OP_G" , "SZ_NA" ], +- "Gb" : [ "OP_G" , "SZ_B" ], +- "Gw" : [ "OP_G" , "SZ_W" ], +- "Gv" : [ "OP_G" , "SZ_V" ], +- "Gy" : [ "OP_G" , "SZ_MDQ" ], +- "Gy" : [ "OP_G" , "SZ_MDQ" ], +- "Gd" : [ "OP_G" , "SZ_D" ], +- "Gq" : [ "OP_G" , "SZ_Q" ], +- "Gx" : [ "OP_G" , "SZ_MDQ" ], +- "Gz" : [ "OP_G" , "SZ_Z" ], +- "M" : [ "OP_M" , "SZ_NA" ], +- "Mb" : [ "OP_M" , "SZ_B" ], +- "Mw" : [ "OP_M" , "SZ_W" ], +- "Ms" : [ "OP_M" , "SZ_W" ], +- "Md" : [ "OP_M" , "SZ_D" ], +- "Mq" : [ "OP_M" , "SZ_Q" ], +- "Mt" : [ "OP_M" , "SZ_T" ], +- "Mo" : [ "OP_M" , "SZ_O" ], +- "MwRv" : [ "OP_MR" , "SZ_WV" ], +- "MdRy" : [ "OP_MR" , "SZ_DY" ], +- "MbRv" : [ "OP_MR" , "SZ_BV" ], +- "I1" : [ "OP_I1" , "SZ_NA" ], +- "I3" : [ "OP_I3" , "SZ_NA" ], +- "Ib" : [ "OP_I" , "SZ_B" ], +- "Isb" : [ "OP_I" , "SZ_SB" ], +- "Iw" : [ "OP_I" , "SZ_W" ], +- "Iv" : [ "OP_I" , "SZ_V" ], +- "Iz" : [ "OP_I" , "SZ_Z" ], +- "Jv" : [ "OP_J" , "SZ_V" ], +- "Jz" : [ "OP_J" , "SZ_Z" ], +- "Jb" : [ "OP_J" , "SZ_B" ], +- "R" : [ "OP_R" , "SZ_RDQ" ], +- "C" : [ "OP_C" , "SZ_NA" ], +- "D" : [ "OP_D" , "SZ_NA" ], +- "S" : [ "OP_S" , "SZ_NA" ], +- "Ob" : [ "OP_O" , "SZ_B" ], +- "Ow" : [ "OP_O" , "SZ_W" ], +- "Ov" : [ "OP_O" , "SZ_V" ], +- "V" : [ "OP_V" , "SZ_O" ], +- "W" : [ "OP_W" , "SZ_O" ], +- "Wsd" : [ "OP_W" , "SZ_O" ], +- "Wss" : [ "OP_W" , "SZ_O" ], +- "P" : [ "OP_P" , "SZ_Q" ], +- "Q" : [ "OP_Q" , "SZ_Q" ], +- "VR" : [ "OP_VR" , "SZ_O" ], +- "PR" : [ "OP_PR" , "SZ_Q" ], +- "AL" : [ "OP_AL" , "SZ_NA" ], +- "CL" : [ "OP_CL" , "SZ_NA" ], +- "DL" : [ "OP_DL" , "SZ_NA" ], +- "BL" : [ "OP_BL" , "SZ_NA" ], +- "AH" : [ "OP_AH" , "SZ_NA" ], +- "CH" : [ "OP_CH" , "SZ_NA" ], +- "DH" : [ "OP_DH" , "SZ_NA" ], +- "BH" : [ "OP_BH" , "SZ_NA" ], +- "AX" : [ "OP_AX" , "SZ_NA" ], +- "CX" : [ "OP_CX" , "SZ_NA" ], +- "DX" : [ "OP_DX" , "SZ_NA" ], +- "BX" : [ "OP_BX" , "SZ_NA" ], +- "SI" : [ "OP_SI" , "SZ_NA" ], +- "DI" : [ "OP_DI" , "SZ_NA" ], +- "SP" : [ "OP_SP" , "SZ_NA" ], +- "BP" : [ "OP_BP" , "SZ_NA" ], +- "eAX" : [ "OP_eAX" , "SZ_NA" ], +- "eCX" : [ "OP_eCX" , "SZ_NA" ], +- "eDX" : [ "OP_eDX" , "SZ_NA" ], +- "eBX" : [ "OP_eBX" , "SZ_NA" ], +- "eSI" : [ "OP_eSI" , "SZ_NA" ], +- "eDI" : [ "OP_eDI" , "SZ_NA" ], +- "eSP" : [ "OP_eSP" , "SZ_NA" ], +- "eBP" : [ "OP_eBP" , "SZ_NA" ], +- "rAX" : [ "OP_rAX" , "SZ_NA" ], +- "rCX" : [ "OP_rCX" , "SZ_NA" ], +- "rBX" : [ "OP_rBX" , "SZ_NA" ], +- "rDX" : [ "OP_rDX" , "SZ_NA" ], +- "rSI" : [ "OP_rSI" , "SZ_NA" ], +- "rDI" : [ "OP_rDI" , "SZ_NA" ], +- "rSP" : [ "OP_rSP" , "SZ_NA" ], +- "rBP" : [ "OP_rBP" , "SZ_NA" ], +- "ES" : [ "OP_ES" , "SZ_NA" ], +- "CS" : [ "OP_CS" , "SZ_NA" ], +- "DS" : [ "OP_DS" , "SZ_NA" ], +- "SS" : [ "OP_SS" , "SZ_NA" ], +- "GS" : [ "OP_GS" , "SZ_NA" ], +- "FS" : [ "OP_FS" , "SZ_NA" ], +- "ST0" : [ "OP_ST0" , "SZ_NA" ], +- "ST1" : [ "OP_ST1" , "SZ_NA" ], +- "ST2" : [ "OP_ST2" , "SZ_NA" ], +- "ST3" : [ "OP_ST3" , "SZ_NA" ], +- "ST4" : [ "OP_ST4" , "SZ_NA" ], +- "ST5" : [ "OP_ST5" , "SZ_NA" ], +- "ST6" : [ "OP_ST6" , "SZ_NA" ], +- "ST7" : [ "OP_ST7" , "SZ_NA" ], +- "NONE" : [ "OP_NONE" , "SZ_NA" ], +- "ALr8b" : [ "OP_ALr8b" , "SZ_NA" ], +- "CLr9b" : [ "OP_CLr9b" , "SZ_NA" ], +- "DLr10b" : [ "OP_DLr10b" , "SZ_NA" ], +- "BLr11b" : [ "OP_BLr11b" , "SZ_NA" ], +- "AHr12b" : [ "OP_AHr12b" , "SZ_NA" ], +- "CHr13b" : [ "OP_CHr13b" , "SZ_NA" ], +- "DHr14b" : [ "OP_DHr14b" , "SZ_NA" ], +- "BHr15b" : [ "OP_BHr15b" , "SZ_NA" ], +- "rAXr8" : [ "OP_rAXr8" , "SZ_NA" ], +- "rCXr9" : [ "OP_rCXr9" , "SZ_NA" ], +- "rDXr10" : [ "OP_rDXr10" , "SZ_NA" ], +- "rBXr11" : [ "OP_rBXr11" , "SZ_NA" ], +- "rSPr12" : [ "OP_rSPr12" , "SZ_NA" ], +- "rBPr13" : [ "OP_rBPr13" , "SZ_NA" ], +- "rSIr14" : [ "OP_rSIr14" , "SZ_NA" ], +- "rDIr15" : [ "OP_rDIr15" , "SZ_NA" ], +- "jWP" : [ "OP_J" , "SZ_WP" ], +- "jDP" : [ "OP_J" , "SZ_DP" ], +- +- } +- +- # +- # opcode prefix dictionary +- # +- PrefixDict = { +- "aso" : "P_aso", +- "oso" : "P_oso", +- "rexw" : "P_rexw", +- "rexb" : "P_rexb", +- "rexx" : "P_rexx", +- "rexr" : "P_rexr", +- "seg" : "P_seg", +- "inv64" : "P_inv64", +- "def64" : "P_def64", +- "depM" : "P_depM", +- "cast1" : "P_c1", +- "cast2" : "P_c2", +- "cast3" : "P_c3", +- "cast" : "P_cast", +- "sext" : "P_sext" +- } +- +- InvalidEntryIdx = 0 +- InvalidEntry = { 'type' : 'invalid', +- 'mnemonic' : 'invalid', +- 'operands' : '', +- 'prefixes' : '', +- 'meta' : '' } +- +- Itab = [] # instruction table +- ItabIdx = 1 # instruction table index +- GtabIdx = 0 # group table index +- GtabMeta = [] +- +- ItabLookup = {} +- +- MnemonicAliases = ( "invalid", "3dnow", "none", "db", "pause" ) +- +- def __init__( self, outputDir ): +- # first itab entry (0) is Invalid +- self.Itab.append( self.InvalidEntry ) +- self.MnemonicsTable.extend( self.MnemonicAliases ) +- self.outputDir = outputDir +- +- def toGroupId( self, id ): +- return 0x8000 | id +- +- def genLookupTable( self, table, scope = '' ): +- idxArray = [ ] +- ( tabIdx, self.GtabIdx ) = ( self.GtabIdx, self.GtabIdx + 1 ) +- self.GtabMeta.append( { 'type' : table[ 'type' ], 'meta' : table[ 'meta' ] } ) +- +- for _idx in range( self.sizeOfTable( table[ 'type' ] ) ): +- idx = "%02x" % _idx +- +- e = self.InvalidEntry +- i = self.InvalidEntryIdx +- +- if idx in table[ 'entries' ].keys(): +- e = table[ 'entries' ][ idx ] +- +- # leaf node (insn) +- if e[ 'type' ] == 'insn': +- ( i, self.ItabIdx ) = ( self.ItabIdx, self.ItabIdx + 1 ) +- self.Itab.append( e ) +- elif e[ 'type' ] != 'invalid': +- i = self.genLookupTable( e, 'static' ) +- +- idxArray.append( i ) +- +- name = "ud_itab__%s" % tabIdx +- self.ItabLookup[ tabIdx ] = name +- +- self.ItabC.write( "\n" ); +- if len( scope ): +- self.ItabC.write( scope + ' ' ) +- self.ItabC.write( "const uint16_t %s[] = {\n" % name ) +- for i in range( len( idxArray ) ): +- if i > 0 and i % 4 == 0: +- self.ItabC.write( "\n" ) +- if ( i%4 == 0 ): +- self.ItabC.write( " /* %2x */" % i) +- if idxArray[ i ] >= 0x8000: +- self.ItabC.write( "%12s," % ("GROUP(%d)" % ( ~0x8000 & idxArray[ i ] ))) +- else: +- self.ItabC.write( "%12d," % ( idxArray[ i ] )) +- self.ItabC.write( "\n" ) +- self.ItabC.write( "};\n" ) +- +- return self.toGroupId( tabIdx ) +- +- def genLookupTableList( self ): +- self.ItabC.write( "\n\n" ); +- self.ItabC.write( "struct ud_lookup_table_list_entry ud_lookup_table_list[] = {\n" ) +- for i in range( len( self.GtabMeta ) ): +- f0 = self.ItabLookup[ i ] + "," +- f1 = ( self.nameOfTable( self.GtabMeta[ i ][ 'type' ] ) ) + "," +- f2 = "\"%s\"" % self.GtabMeta[ i ][ 'meta' ] +- self.ItabC.write( " /* %03d */ { %s %s %s },\n" % ( i, f0, f1, f2 ) ) +- self.ItabC.write( "};" ) +- +- def genInsnTable( self ): +- self.ItabC.write( "struct ud_itab_entry ud_itab[] = {\n" ); +- idx = 0 +- for e in self.Itab: +- opr_c = [ "O_NONE", "O_NONE", "O_NONE" ] +- pfx_c = [] +- opr = e[ 'operands' ] +- for i in range(len(opr)): +- if not (opr[i] in self.OperandDict.keys()): +- print("error: invalid operand declaration: %s\n" % opr[i]) +- opr_c[i] = "O_" + opr[i] +- opr = "%s %s %s" % (opr_c[0] + ",", opr_c[1] + ",", opr_c[2]) +- +- for p in e['prefixes']: +- if not ( p in self.PrefixDict.keys() ): +- print("error: invalid prefix specification: %s \n" % pfx) +- pfx_c.append( self.PrefixDict[p] ) +- if len(e['prefixes']) == 0: +- pfx_c.append( "P_none" ) +- pfx = "|".join( pfx_c ) +- +- self.ItabC.write( " /* %04d */ { UD_I%s %s, %s },\n" \ +- % ( idx, e[ 'mnemonic' ] + ',', opr, pfx ) ) +- idx += 1 +- self.ItabC.write( "};\n" ) +- +- self.ItabC.write( "\n\n" ); +- self.ItabC.write( "const char * ud_mnemonics_str[] = {\n" ) +- self.ItabC.write( ",\n ".join( [ "\"%s\"" % m for m in self.MnemonicsTable ] ) ) +- self.ItabC.write( "\n};\n" ) +- +- +- def genItabH( self ): +- self.ItabH = open( os.path.join(self.outputDir, "udis86_itab.h"), "w" ) +- +- # Generate Table Type Enumeration +- self.ItabH.write( "#ifndef UD_ITAB_H\n" ) +- self.ItabH.write( "#define UD_ITAB_H\n\n" ) +- +- # table type enumeration +- self.ItabH.write( "/* ud_table_type -- lookup table types (see lookup.c) */\n" ) +- self.ItabH.write( "enum ud_table_type {\n " ) +- enum = [ self.TableInfo[ k ][ 'name' ] for k in self.TableInfo.keys() ] +- self.ItabH.write( ",\n ".join( enum ) ) +- self.ItabH.write( "\n};\n\n" ); +- +- # mnemonic enumeration +- self.ItabH.write( "/* ud_mnemonic -- mnemonic constants */\n" ) +- enum = "enum ud_mnemonic_code {\n " +- enum += ",\n ".join( [ "UD_I%s" % m for m in self.MnemonicsTable ] ) +- enum += "\n} UD_ATTR_PACKED;\n" +- self.ItabH.write( enum ) +- self.ItabH.write( "\n" ) +- +- self.ItabH.write("\n/* itab entry operand definitions */\n"); +- operands = self.OperandDict.keys() +- operands.sort() +- for o in operands: +- self.ItabH.write("#define O_%-7s { %-12s %-8s }\n" % +- (o, self.OperandDict[o][0] + ",", self.OperandDict[o][1])); +- self.ItabH.write("\n\n"); +- +- self.ItabH.write( "extern const char * ud_mnemonics_str[];\n" ) +- +- self.ItabH.write( "#define GROUP(n) (0x8000 | (n))" ) +- +- self.ItabH.write( "\n#endif /* UD_ITAB_H */\n" ) +- +- self.ItabH.close() +- +- +- def genItabC( self ): +- self.ItabC = open( os.path.join(self.outputDir, "udis86_itab.c"), "w" ) +- self.ItabC.write( "/* itab.c -- generated by itab.py, do no edit" ) +- self.ItabC.write( " */\n" ); +- self.ItabC.write( "#include \"udis86_decode.h\"\n\n" ); +- +- self.genLookupTable( self.OpcodeTable0 ) +- self.genLookupTableList() +- self.genInsnTable() +- +- self.ItabC.close() +- +- def genItab( self ): +- self.genItabC() +- self.genItabH() +- +-def main(): +- parser = OptionParser() +- parser.add_option("--outputDir", dest="outputDir", default="") +- options, args = parser.parse_args() +- generator = UdItabGenerator(os.path.normpath(options.outputDir)) +- optableXmlParser = ud_optable.UdOptableXmlParser() +- optableXmlParser.parse( args[ 0 ], generator.addInsnDef ) +- +- generator.genItab() +- +-if __name__ == '__main__': +- main() +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/optable.xml b/Source/JavaScriptCore/disassembler/udis86/optable.xml +--- a/Source/JavaScriptCore/disassembler/udis86/optable.xml 2016-05-21 18:54:11.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/optable.xml 2019-06-10 00:48:46.000000000 +0300 +@@ -2,37 +2,132 @@ + + + ++ ++ + + aaa + +- 37 +- inv64 ++ 37 /m=!64 + + + + + aad + +- d5 ++ d5 /m=!64 + Ib +- inv64 + + + + + aam + +- d4 ++ d4 /m=!64 + Ib +- inv64 + + + + + aas + +- 3f +- inv64 ++ 3f /m=!64 + + + +@@ -65,8 +160,7 @@ + + oso rexw + 15 +- rAX Iz +- sext ++ rAX sIz + + + aso rexr rexx rexb +@@ -75,21 +169,19 @@ + + + aso rexr rexx rexb +- 82 /reg=2 ++ 82 /reg=2 /m=!64 + Eb Ib + inv64 + + + aso oso rexw rexr rexx rexb + 81 /reg=2 +- Ev Iz +- sext ++ Ev sIz + + + aso oso rexw rexr rexx rexb + 83 /reg=2 +- Ev Ib +- sext ++ Ev sIb + + + +@@ -122,8 +214,7 @@ + + oso rexw + 05 +- rAX Iz +- sext ++ rAX sIz + + + aso rexr rexx rexb +@@ -132,43 +223,39 @@ + + + aso rexr rexx rexb +- 82 /reg=0 ++ 82 /reg=0 /m=!64 + Eb Ib + inv64 + + + aso oso rexw rexr rexx rexb + 81 /reg=0 +- Ev Iz +- sext ++ Ev sIz + + + aso oso rexw rexr rexx rexb + 83 /reg=0 +- Ev Ib +- sext ++ Ev sIb + + + +- +- + + addpd + +- aso rexr rexx rexb +- sse66 0f 58 +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 58 ++ V H W ++ sse2 avx + + + + + addps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 58 +- V W ++ V H W ++ sse avx + + + +@@ -176,8 +263,9 @@ + addsd + + aso rexr rexx rexb +- ssef2 0f 58 +- V W ++ /sse=f2 0f 58 ++ V H W ++ sse2 avx + + + +@@ -185,12 +273,94 @@ + addss + + aso rexr rexx rexb +- ssef3 0f 58 ++ /sse=f3 0f 58 ++ V H W ++ sse avx ++ ++ ++ ++ ++ addsubpd ++ ++ aso rexr rexx rexb ++ /sse=66 0f d0 ++ V H W ++ sse3 avx ++ ++ ++ ++ ++ addsubps ++ ++ aso rexr rexx rexb ++ /sse=f2 0f d0 ++ V H W ++ sse3 avx ++ ++ ++ ++ ++ aesdec ++ ++ aso rexr rexx rexb ++ /sse=66 0f 38 de ++ V H W ++ aesni avx ++ ++ ++ ++ ++ aesdeclast ++ ++ aso rexr rexx rexb ++ /sse=66 0f 38 df + V W ++ aesni avx + + + +- ++ ++ aesenc ++ aesni ++ ++ aso rexr rexx rexb ++ /sse=66 0f 38 dc ++ V W ++ aesni avx ++ ++ ++ ++ ++ aesenclast ++ aesni avx ++ ++ aso rexr rexx rexb ++ /sse=66 0f 38 dd ++ V H W ++ ++ ++ ++ ++ aesimc ++ ++ aso rexr rexx rexb ++ /sse=66 0f 38 db ++ V W ++ aesni avx ++ ++ ++ ++ ++ aeskeygenassist ++ ++ aso rexr rexx rexb ++ /sse=66 0f 3a df ++ V W Ib ++ aesni avx ++ ++ ++ ++ + and + + aso rexr rexx rexb +@@ -219,8 +389,7 @@ + + oso rexw + 25 +- rAX Iz +- sext ++ rAX sIz + + + aso rexw rexr rexx rexb +@@ -229,30 +398,29 @@ + + + aso rexr rexx rexb +- 82 /reg=4 ++ 82 /reg=4 /m=!64 + Eb Ib + inv64 + + + aso oso rexw rexr rexx rexb + 81 /reg=4 +- Ev Iz +- sext ++ Ev sIz + + + aso oso rexw rexr rexx rexb + 83 /reg=4 +- Ev Ib +- sext ++ Ev sIb + + + + + andpd + +- aso rexr rexx rexb +- sse66 0f 54 +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 54 ++ V H W ++ sse2 avx + + + +@@ -261,7 +429,8 @@ + + aso rexr rexx rexb + 0f 54 +- V W ++ V H W ++ sse avx + + + +@@ -269,8 +438,9 @@ + andnpd + + aso rexr rexx rexb +- sse66 0f 55 +- V W ++ /sse=66 0f 55 ++ V H W ++ sse2 avx + + + +@@ -279,7 +449,8 @@ + + aso rexr rexx rexb + 0f 55 +- V W ++ V H W ++ sse2 avx + + + +@@ -287,15 +458,8 @@ + arpl + + aso +- 63 /m=16 +- Ew Gw +- inv64 +- +- +- aso +- 63 /m=32 ++ 63 /m=!64 + Ew Gw +- inv64 + + + +@@ -304,150 +468,27 @@ + + aso oso rexw rexx rexr rexb + 63 /m=64 +- Gv Ed +- +- +- +- +- bound +- +- aso oso +- 62 +- Gv M +- inv64 +- +- +- +- +- bsf +- +- aso oso rexw rexr rexx rexb +- 0f bc +- Gv Ev +- +- +- +- +- bsr +- +- aso oso rexw rexr rexx rexb +- 0f bd +- Gv Ev +- +- +- +- +- bswap +- +- oso rexw rexb +- 0f c8 +- rAXr8 +- +- +- oso rexw rexb +- 0f c9 +- rCXr9 +- +- +- oso rexw rexb +- 0f ca +- rDXr10 +- +- +- oso rexw rexb +- 0f cb +- rBXr11 +- +- +- oso rexw rexb +- 0f cc +- rSPr12 +- +- +- oso rexw rexb +- 0f cd +- rBPr13 +- +- +- oso rexw rexb +- 0f ce +- rSIr14 +- +- +- oso rexw rexb +- 0f cf +- rDIr15 +- +- +- +- +- bt +- +- aso oso rexw rexr rexx rexb +- 0f ba /reg=4 +- Ev Ib +- +- +- aso oso rexw rexr rexx rexb +- 0f a3 +- Ev Gv +- +- +- +- +- btc +- +- aso oso rexw rexr rexx rexb +- 0f bb +- Ev Gv +- +- +- aso oso rexw rexr rexx rexb +- 0f ba /reg=7 +- Ev Ib +- +- +- +- +- btr +- +- aso oso rexw rexr rexx rexb +- 0f b3 +- Ev Gv +- +- +- aso oso rexw rexr rexx rexb +- 0f ba /reg=6 +- Ev Ib ++ Gq Ed + + + + +- bts +- +- aso oso rexw rexr rexx rexb +- 0f ab +- Ev Gv +- ++ call + + aso oso rexw rexr rexx rexb +- 0f ba /reg=5 +- Ev Ib ++ ff /reg=2 /m=!64 ++ Ev + +- +- +- +- call + + aso oso rexw rexr rexx rexb +- ff /reg=2 +- Ev ++ ff /reg=2 /m=64 ++ Eq + def64 + + + aso oso rexw rexr rexx rexb + ff /reg=3 +- Ep ++ Fv + + + oso +@@ -457,9 +498,8 @@ + + + oso +- 9a +- Ap +- inv64 ++ 9a /m=!64 ++ Av + + + +@@ -712,7 +752,7 @@ + + oso rexw + 3d +- rAX Iz ++ rAX sIz + + + aso rexr rexx rexb +@@ -721,43 +761,46 @@ + + + aso rexr rexx rexb +- 82 /reg=7 ++ 82 /reg=7 /m=!64 + Eb Ib + inv64 + + + aso oso rexw rexr rexx rexb + 81 /reg=7 +- Ev Iz ++ Ev sIz + + + aso oso rexw rexr rexx rexb + 83 /reg=7 +- Ev Ib ++ Ev sIb + + + + + cmppd + +- aso rexr rexx rexb +- sse66 0f c2 +- V W Ib ++ aso rexr rexx rexb vexl ++ /sse=66 0f c2 ++ V H W Ib ++ sse2 avx + + + + + cmpps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f c2 +- V W Ib ++ V H W Ib ++ sse2 avx + + + + + cmpsb + ++ repz seg + a6 + + +@@ -765,7 +808,7 @@ + + cmpsw + +- oso rexw ++ repz oso rexw seg + a7 /o=16 + + +@@ -773,20 +816,21 @@ + + cmpsd + +- oso rexw ++ repz oso rexw seg + a7 /o=32 + + + aso rexr rexx rexb +- ssef2 0f c2 +- V W Ib ++ /sse=f2 0f c2 ++ V H W Ib ++ sse2 avx + + + + + cmpsq + +- oso rexw ++ repz oso rexw seg + a7 /o=64 + + +@@ -795,8 +839,9 @@ + cmpss + + aso rexr rexx rexb +- ssef3 0f c2 +- V W Ib ++ /sse=f3 0f c2 ++ V H W Ib ++ sse2 avx + + + +@@ -818,7 +863,21 @@ + cmpxchg8b + + aso rexr rexx rexb +- 0f c7 /reg=1 ++ 0f c7 /mod=!11 /reg=1 /o=16 ++ M ++ ++ ++ aso rexr rexx rexb ++ 0f c7 /mod=!11 /reg=1 /o=32 ++ M ++ ++ ++ ++ ++ cmpxchg16b ++ ++ aso rexr rexx rexb ++ 0f c7 /mod=!11 /reg=1 /o=64 + M + + +@@ -827,8 +886,9 @@ + comisd + + aso rexr rexx rexb +- sse66 0f 2f +- V W ++ /sse=66 0f 2f ++ Vsd Wsd ++ sse2 avx + + + +@@ -838,6 +898,7 @@ + aso rexr rexx rexb + 0f 2f + V W ++ sse2 avx + + + +@@ -851,9 +912,10 @@ + + cvtdq2pd + +- aso rexr rexx rexb +- ssef3 0f e6 +- V W ++ aso rexr rexx rexb vexl ++ /sse=f3 0f e6 ++ V Wdq ++ sse2 avx + + + +@@ -863,15 +925,17 @@ + aso rexr rexx rexb + 0f 5b + V W ++ sse2 avx + + + + + cvtpd2dq + +- aso rexr rexx rexb +- ssef2 0f e6 +- V W ++ aso rexr rexx rexb vexl ++ /sse=f2 0f e6 ++ Vdq W ++ sse2 avx + + + +@@ -879,7 +943,7 @@ + cvtpd2pi + + aso rexr rexx rexb +- sse66 0f 2d ++ /sse=66 0f 2d + P W + + +@@ -887,9 +951,10 @@ + + cvtpd2ps + +- aso rexr rexx rexb +- sse66 0f 5a +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 5a ++ Vdq W ++ sse2 avx + + + +@@ -906,7 +971,7 @@ + cvtpi2pd + + aso rexr rexx rexb +- sse66 0f 2a ++ /sse=66 0f 2a + V Q + + +@@ -914,27 +979,29 @@ + + cvtps2dq + +- aso rexr rexx rexb +- sse66 0f 5b ++ aso rexr rexx rexb vexl ++ /sse=66 0f 5b + V W ++ sse2 avx + + + + +- cvtps2pi ++ cvtps2pd + +- aso rexr rexx rexb +- 0f 2d +- P W ++ aso rexr rexx rexb vexl ++ 0f 5a ++ V Wdq ++ sse2 avx + + + + +- cvtps2pd ++ cvtps2pi + + aso rexr rexx rexb +- 0f 5a +- V W ++ 0f 2d ++ P MqU + + + +@@ -942,8 +1009,9 @@ + cvtsd2si + + aso rexw rexr rexx rexb +- ssef2 0f 2d +- Gy W ++ /sse=f2 0f 2d ++ Gy MqU ++ sse2 avx + + + +@@ -951,26 +1019,29 @@ + cvtsd2ss + + aso rexr rexx rexb +- ssef2 0f 5a +- V W ++ /sse=f2 0f 5a ++ V H W ++ sse2 avx + + + + +- cvtsi2ss ++ cvtsi2sd + + aso rexw rexr rexx rexb +- ssef3 0f 2a +- V Ex ++ /sse=f2 0f 2a ++ V H Ey ++ sse2 avx + + + + +- cvtss2si ++ cvtsi2ss + + aso rexw rexr rexx rexb +- ssef3 0f 2d +- Gy W ++ /sse=f3 0f 2a ++ V H Ey ++ sse avx + + + +@@ -978,35 +1049,48 @@ + cvtss2sd + + aso rexr rexx rexb +- ssef3 0f 5a +- V W ++ /sse=f3 0f 5a ++ V H W ++ sse2 avx + + + + +- cvttpd2pi ++ cvtss2si + +- aso rexr rexx rexb +- sse66 0f 2c +- P W ++ aso rexw rexr rexx rexb ++ /sse=f3 0f 2d ++ Gy MdU ++ sse avx + + + + + cvttpd2dq + ++ aso rexr rexx rexb vexl ++ /sse=66 0f e6 ++ Vdq W ++ sse2 avx ++ ++ ++ ++ ++ cvttpd2pi ++ + aso rexr rexx rexb +- sse66 0f e6 +- V W ++ /sse=66 0f 2c ++ P W + + + + + cvttps2dq + +- aso rexr rexx rexb +- ssef3 0f 5b ++ aso rexr rexx rexb vexl ++ /sse=f3 0f 5b + V W ++ sse2 avx + + + +@@ -1023,17 +1107,9 @@ + cvttsd2si + + aso rexw rexr rexx rexb +- ssef2 0f 2c +- Gy Wsd +- +- +- +- +- cvtsi2sd +- +- aso rexw rexr rexx rexb +- ssef2 0f 2a +- V Ex ++ /sse=f2 0f 2c ++ Gy MqU ++ sse2 avx + + + +@@ -1041,8 +1117,9 @@ + cvttss2si + + aso rexw rexr rexx rexb +- ssef3 0f 2c +- Gy Wsd ++ /sse=f3 0f 2c ++ Gy MdU ++ sse2 avx + + + +@@ -1073,7 +1150,7 @@ + + daa + +- 27 ++ 27 /m=!64 + inv64 + + +@@ -1081,7 +1158,7 @@ + + das + +- 2f ++ 2f /m=!64 + inv64 + + +@@ -1091,42 +1168,42 @@ + + oso + 48 +- eAX ++ R0z + + + oso + 49 +- eCX ++ R1z + + + oso + 4a +- eDX ++ R2z + + + oso + 4b +- eBX ++ R3z + + + oso + 4c +- eSP ++ R4z + + + oso + 4d +- eBP ++ R5z + + + oso + 4e +- eSI ++ R6z + + + oso + 4f +- eDI ++ R7z + + + aso rexw rexr rexx rexb +@@ -1157,9 +1234,10 @@ + + divpd + +- aso rexr rexx rexb +- sse66 0f 5e +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 5e ++ V H W ++ sse2 avx + + + +@@ -1168,7 +1246,8 @@ + + aso rexr rexx rexb + 0f 5e +- V W ++ V H W ++ sse avx + + + +@@ -1176,8 +1255,9 @@ + divsd + + aso rexr rexx rexb +- ssef2 0f 5e +- V W ++ /sse=f2 0f 5e ++ V H MqU ++ sse2 avx + + + +@@ -1185,8 +1265,29 @@ + divss + + aso rexr rexx rexb +- ssef3 0f 5e +- V W ++ /sse=f3 0f 5e ++ V H MdU ++ sse avx ++ ++ ++ ++ ++ dppd ++ ++ aso rexr rexx rexb ++ /sse=66 0f 3a 41 ++ V H W Ib ++ sse4.1 avx ++ ++ ++ ++ ++ dpps ++ ++ aso rexr rexx rexb vexl ++ /sse=66 0f 3a 40 ++ V H W Ib ++ sse4.1 avx + + + +@@ -1202,13 +1303,23 @@ + + c8 + Iw Ib +- def64 depM ++ def64 ++ ++ ++ ++ ++ extractps ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 3a 17 ++ MdRy V Ib ++ sse4.1 avx + + + + + f2xm1 +- X87 ++ X87 + + d9 /mod=11 /x87=30 + +@@ -1216,7 +1327,7 @@ + + + fabs +- X87 ++ X87 + + d9 /mod=11 /x87=21 + +@@ -1224,7 +1335,7 @@ + + + fadd +- X87 ++ X87 + + aso rexr rexx rexb + dc /mod=!11 /reg=0 +@@ -1303,7 +1414,7 @@ + + + faddp +- X87 ++ X87 + + de /mod=11 /x87=00 + ST0 ST0 +@@ -1340,7 +1451,7 @@ + + + fbld +- X87 ++ X87 + + aso rexr rexx rexb + df /mod=!11 /reg=4 +@@ -1350,7 +1461,7 @@ + + + fbstp +- X87 ++ X87 + + aso rexr rexx rexb + df /mod=!11 /reg=6 +@@ -1360,7 +1471,7 @@ + + + fchs +- X87 ++ X87 + + d9 /mod=11 /x87=20 + +@@ -1368,7 +1479,7 @@ + + + fclex +- X87 ++ X87 + + db /mod=11 /x87=22 + +@@ -1376,7 +1487,7 @@ + + + fcmovb +- X87 ++ X87 + + da /mod=11 /x87=00 + ST0 ST0 +@@ -1413,7 +1524,7 @@ + + + fcmove +- X87 ++ X87 + + da /mod=11 /x87=08 + ST0 ST0 +@@ -1450,7 +1561,7 @@ + + + fcmovbe +- X87 ++ X87 + + da /mod=11 /x87=10 + ST0 ST0 +@@ -1487,7 +1598,7 @@ + + + fcmovu +- X87 ++ X87 + + da /mod=11 /x87=18 + ST0 ST0 +@@ -1524,7 +1635,7 @@ + + + fcmovnb +- X87 ++ X87 + + db /mod=11 /x87=00 + ST0 ST0 +@@ -1561,7 +1672,7 @@ + + + fcmovne +- X87 ++ X87 + + db /mod=11 /x87=08 + ST0 ST0 +@@ -1598,7 +1709,7 @@ + + + fcmovnbe +- X87 ++ X87 + + db /mod=11 /x87=10 + ST0 ST0 +@@ -1635,7 +1746,7 @@ + + + fcmovnu +- X87 ++ X87 + + db /mod=11 /x87=18 + ST0 ST0 +@@ -1672,7 +1783,7 @@ + + + fucomi +- X87 ++ X87 + + db /mod=11 /x87=28 + ST0 ST0 +@@ -1709,7 +1820,7 @@ + + + fcom +- X87 ++ X87 + + aso rexr rexx rexb + d8 /mod=!11 /reg=2 +@@ -1756,7 +1867,7 @@ + + + fcom2 +- X87 UNDOC ++ X87 UNDOC + + dc /mod=11 /x87=10 + ST0 +@@ -1793,7 +1904,7 @@ + + + fcomp3 +- X87 UNDOC ++ X87 UNDOC + + dc /mod=11 /x87=18 + ST0 +@@ -1830,7 +1941,7 @@ + + + fcomi +- X87 ++ X87 + + db /mod=11 /x87=30 + ST0 ST0 +@@ -1867,7 +1978,7 @@ + + + fucomip +- X87 ++ X87 + + df /mod=11 /x87=28 + ST0 ST0 +@@ -1904,7 +2015,7 @@ + + + fcomip +- X87 ++ X87 + + df /mod=11 /x87=30 + ST0 ST0 +@@ -1941,7 +2052,7 @@ + + + fcomp +- X87 ++ X87 + + aso rexr rexx rexb + d8 /mod=!11 /reg=3 +@@ -1988,7 +2099,7 @@ + + + fcomp5 +- X87 UNDOC ++ X87 UNDOC + + de /mod=11 /x87=10 + ST0 +@@ -2025,7 +2136,7 @@ + + + fcompp +- X87 ++ X87 + + de /mod=11 /x87=19 + +@@ -2033,7 +2144,7 @@ + + + fcos +- X87 ++ X87 + + d9 /mod=11 /x87=3f + +@@ -2041,7 +2152,7 @@ + + + fdecstp +- X87 ++ X87 + + d9 /mod=11 /x87=36 + +@@ -2049,7 +2160,7 @@ + + + fdiv +- X87 ++ X87 + + aso rexr rexx rexb + dc /mod=!11 /reg=6 +@@ -2128,7 +2239,7 @@ + + + fdivp +- X87 ++ X87 + + de /mod=11 /x87=38 + ST0 ST0 +@@ -2165,7 +2276,7 @@ + + + fdivr +- X87 ++ X87 + + aso rexr rexx rexb + dc /mod=!11 /reg=7 +@@ -2244,7 +2355,7 @@ + + + fdivrp +- X87 ++ X87 + + de /mod=11 /x87=30 + ST0 ST0 +@@ -2288,7 +2399,7 @@ + + + ffree +- X87 ++ X87 + + dd /mod=11 /x87=00 + ST0 +@@ -2325,7 +2436,7 @@ + + + ffreep +- X87 ++ X87 + + df /mod=11 /x87=00 + ST0 +@@ -2362,7 +2473,7 @@ + + + ficom +- X87 ++ X87 + + aso rexr rexx rexb + de /mod=!11 /reg=2 +@@ -2377,7 +2488,7 @@ + + + ficomp +- X87 ++ X87 + + aso rexr rexx rexb + de /mod=!11 /reg=3 +@@ -2392,7 +2503,7 @@ + + + fild +- X87 ++ X87 + + aso rexr rexx rexb + df /mod=!11 /reg=0 +@@ -2411,8 +2522,8 @@ + + + +- fncstp +- X87 ++ fincstp ++ X87 + + d9 /mod=11 /x87=37 + +@@ -2420,7 +2531,7 @@ + + + fninit +- X87 ++ X87 + + db /mod=11 /x87=23 + +@@ -2428,7 +2539,7 @@ + + + fiadd +- X87 ++ X87 + + aso rexr rexx rexb + da /mod=!11 /reg=0 +@@ -2443,7 +2554,7 @@ + + + fidivr +- X87 ++ X87 + + aso rexr rexx rexb + da /mod=!11 /reg=7 +@@ -2458,7 +2569,7 @@ + + + fidiv +- X87 ++ X87 + + aso rexr rexx rexb + da /mod=!11 /reg=6 +@@ -2473,7 +2584,7 @@ + + + fisub +- X87 ++ X87 + + aso rexr rexx rexb + da /mod=!11 /reg=4 +@@ -2488,7 +2599,7 @@ + + + fisubr +- X87 ++ X87 + + aso rexr rexx rexb + da /mod=!11 /reg=5 +@@ -2503,7 +2614,7 @@ + + + fist +- X87 ++ X87 + + aso rexr rexx rexb + df /mod=!11 /reg=2 +@@ -2518,7 +2629,7 @@ + + + fistp +- X87 ++ X87 + + aso rexr rexx rexb + df /mod=!11 /reg=3 +@@ -2538,7 +2649,7 @@ + + + fisttp +- X87 ++ X87 + + aso rexr rexx rexb + db /mod=!11 /reg=1 +@@ -2558,7 +2669,7 @@ + + + fld +- X87 ++ X87 + + aso rexr rexx rexb + db /mod=!11 /reg=5 +@@ -2610,7 +2721,7 @@ + + + fld1 +- X87 ++ X87 + + d9 /mod=11 /x87=28 + +@@ -2618,7 +2729,7 @@ + + + fldl2t +- X87 ++ X87 + + d9 /mod=11 /x87=29 + +@@ -2626,15 +2737,15 @@ + + + fldl2e +- X87 ++ X87 + + d9 /mod=11 /x87=2a + + + + +- fldlpi +- X87 ++ fldpi ++ X87 + + d9 /mod=11 /x87=2b + +@@ -2642,7 +2753,7 @@ + + + fldlg2 +- X87 ++ X87 + + d9 /mod=11 /x87=2c + +@@ -2650,7 +2761,7 @@ + + + fldln2 +- X87 ++ X87 + + d9 /mod=11 /x87=2d + +@@ -2658,7 +2769,7 @@ + + + fldz +- X87 ++ X87 + + d9 /mod=11 /x87=2e + +@@ -2666,7 +2777,7 @@ + + + fldcw +- X87 ++ X87 + + aso rexr rexx rexb + d9 /mod=!11 /reg=5 +@@ -2676,7 +2787,7 @@ + + + fldenv +- X87 ++ X87 + + aso rexr rexx rexb + d9 /mod=!11 /reg=4 +@@ -2686,7 +2797,7 @@ + + + fmul +- X87 ++ X87 + + aso rexr rexx rexb + dc /mod=!11 /reg=1 +@@ -2765,7 +2876,7 @@ + + + fmulp +- X87 ++ X87 + + de /mod=11 /x87=08 + ST0 ST0 +@@ -2802,7 +2913,7 @@ + + + fimul +- X87 ++ X87 + + aso rexr rexx rexb + da /mod=!11 /reg=1 +@@ -2817,15 +2928,39 @@ + + + fnop +- X87 ++ X87 + + d9 /mod=11 /x87=10 + + ++ ++ ++ fndisi ++ X87 ++ ++ db /mod=11 /x87=21 ++ ++ ++ ++ ++ fneni ++ X87 ++ ++ db /mod=11 /x87=20 ++ ++ ++ ++ ++ fnsetpm ++ X87 ++ ++ db /mod=11 /x87=24 ++ ++ + + + fpatan +- X87 ++ X87 + + d9 /mod=11 /x87=33 + +@@ -2833,7 +2968,7 @@ + + + fprem +- X87 ++ X87 + + d9 /mod=11 /x87=38 + +@@ -2841,7 +2976,7 @@ + + + fprem1 +- X87 ++ X87 + + d9 /mod=11 /x87=35 + +@@ -2849,7 +2984,7 @@ + + + fptan +- X87 ++ X87 + + d9 /mod=11 /x87=32 + +@@ -2857,7 +2992,7 @@ + + + frndint +- X87 ++ X87 + + d9 /mod=11 /x87=3c + +@@ -2865,17 +3000,25 @@ + + + frstor +- X87 ++ X87 + + aso rexr rexx rexb + dd /mod=!11 /reg=4 + M + + ++ ++ ++ frstpm ++ X87 ++ ++ db /mod=11 /x87=25 ++ ++ + + + fnsave +- X87 ++ X87 + + aso rexr rexx rexb + dd /mod=!11 /reg=6 +@@ -2885,7 +3028,7 @@ + + + fscale +- X87 ++ X87 + + d9 /mod=11 /x87=3d + +@@ -2893,7 +3036,7 @@ + + + fsin +- X87 ++ X87 + + d9 /mod=11 /x87=3e + +@@ -2901,7 +3044,7 @@ + + + fsincos +- X87 ++ X87 + + d9 /mod=11 /x87=3b + +@@ -2909,7 +3052,7 @@ + + + fsqrt +- X87 ++ X87 + + d9 /mod=11 /x87=3a + +@@ -2917,7 +3060,7 @@ + + + fstp +- X87 ++ X87 + + aso rexr rexx rexb + db /mod=!11 /reg=7 +@@ -3077,7 +3220,7 @@ + + + fst +- X87 ++ X87 + + aso rexr rexx rexb + d9 /mod=!11 /reg=2 +@@ -3124,7 +3267,7 @@ + + + fnstcw +- X87 ++ X87 + + aso rexr rexx rexb + d9 /mod=!11 /reg=7 +@@ -3134,7 +3277,7 @@ + + + fnstenv +- X87 ++ X87 + + aso rexr rexx rexb + d9 /mod=!11 /reg=6 +@@ -3144,7 +3287,7 @@ + + + fnstsw +- X87 ++ X87 + + aso rexr rexx rexb + dd /mod=!11 /reg=7 +@@ -3158,7 +3301,7 @@ + + + fsub +- X87 ++ X87 + + aso rexr rexx rexb + d8 /mod=!11 /reg=4 +@@ -3237,7 +3380,7 @@ + + + fsubp +- X87 ++ X87 + + de /mod=11 /x87=28 + ST0 ST0 +@@ -3274,7 +3417,7 @@ + + + fsubr +- X87 ++ X87 + + aso rexr rexx rexb + dc /mod=!11 /reg=5 +@@ -3353,7 +3496,7 @@ + + + fsubrp +- X87 ++ X87 + + de /mod=11 /x87=20 + ST0 ST0 +@@ -3390,7 +3533,7 @@ + + + ftst +- X87 ++ X87 + + d9 /mod=11 /x87=24 + +@@ -3398,7 +3541,7 @@ + + + fucom +- X87 ++ X87 + + dd /mod=11 /x87=20 + ST0 +@@ -3435,7 +3578,7 @@ + + + fucomp +- X87 ++ X87 + + dd /mod=11 /x87=28 + ST0 +@@ -3472,7 +3615,7 @@ + + + fucompp +- X87 ++ X87 + + da /mod=11 /x87=29 + +@@ -3480,7 +3623,7 @@ + + + fxam +- X87 ++ X87 + + d9 /mod=11 /x87=25 + +@@ -3488,7 +3631,7 @@ + + + fxch +- X87 ++ X87 + + d9 /mod=11 /x87=08 + ST0 ST0 +@@ -3525,7 +3668,7 @@ + + + fxch4 +- X87 ++ X87 + + dd /mod=11 /x87=08 + ST0 +@@ -3562,7 +3705,7 @@ + + + fxch7 +- X87 ++ X87 + + df /mod=11 /x87=08 + ST0 +@@ -3601,7 +3744,7 @@ + fxrstor + + aso rexw rexr rexx rexb +- 0f ae /mod=11 /reg=1 ++ 0f ae /mod=!11 /reg=1 + M + + +@@ -3610,14 +3753,14 @@ + fxsave + + aso rexw rexr rexx rexb +- 0f ae /mod=11 /reg=0 ++ 0f ae /mod=!11 /reg=0 + M + + + + +- fpxtract +- X87 ++ fxtract ++ X87 + + d9 /mod=11 /x87=34 + +@@ -3625,7 +3768,7 @@ + + + fyl2x +- X87 ++ X87 + + d9 /mod=11 /x87=31 + +@@ -3633,7 +3776,7 @@ + + + fyl2xp1 +- X87 ++ X87 + + d9 /mod=11 /x87=39 + +@@ -3703,13 +3846,11 @@ + aso oso rexw rexr rexx rexb + 69 + Gv Ev Iz +- sext + + + aso oso rexw rexr rexx rexb + 6b +- Gv Ev Ib +- sext ++ Gv Ev sIb + + + +@@ -3718,42 +3859,42 @@ + + oso + 40 +- eAX ++ R0z + + + oso + 41 +- eCX ++ R1z + + + oso + 42 +- eDX ++ R2z + + + oso + 43 +- eBX ++ R3z + + + oso + 44 +- eSP ++ R4z + + + oso + 45 +- eBP ++ R5z + + + oso + 46 +- eSI ++ R6z + + + oso + 47 +- eDI ++ R7z + + + aso oso rexw rexr rexx rexb +@@ -3770,6 +3911,7 @@ + + insb + ++ rep seg + 6c + + +@@ -3777,7 +3919,7 @@ + + insw + +- oso ++ rep oso seg + 6d /o=16 + + +@@ -3785,7 +3927,7 @@ + + insd + +- oso ++ rep oso seg + 6d /o=32 + + +@@ -3815,7 +3957,7 @@ + + into + +- ce ++ ce /m=!64 + inv64 + + +@@ -3831,11 +3973,11 @@ + invept + intel + +- sse66 0f 38 80 /m=32 ++ /sse=66 0f 38 80 /m=32 + Gd Mo + + +- sse66 0f 38 80 /m=64 ++ /sse=66 0f 38 80 /m=64 + Gq Mo + + +@@ -3861,11 +4003,11 @@ + invvpid + intel + +- sse66 0f 38 81 /m=32 ++ /sse=66 0f 38 81 /m=32 + Gd Mo + + +- sse66 0f 38 81 /m=64 ++ /sse=66 0f 38 81 /m=64 + Gq Mo + + +@@ -3904,7 +4046,7 @@ + oso + 0f 80 + Jz +- def64 depM ++ def64 + + + +@@ -3918,7 +4060,7 @@ + oso + 0f 81 + Jz +- def64 depM ++ def64 + + + +@@ -3932,7 +4074,7 @@ + oso + 0f 82 + Jz +- def64 depM ++ def64 + + + +@@ -3946,7 +4088,7 @@ + oso + 0f 83 + Jz +- def64 depM ++ def64 + + + +@@ -3960,7 +4102,7 @@ + oso + 0f 84 + Jz +- def64 depM ++ def64 + + + +@@ -3974,7 +4116,7 @@ + oso + 0f 85 + Jz +- def64 depM ++ def64 + + + +@@ -3988,7 +4130,7 @@ + oso + 0f 86 + Jz +- def64 depM ++ def64 + + + +@@ -4002,7 +4144,7 @@ + oso + 0f 87 + Jz +- def64 depM ++ def64 + + + +@@ -4016,7 +4158,7 @@ + oso + 0f 88 + Jz +- def64 depM ++ def64 + + + +@@ -4030,7 +4172,7 @@ + oso + 0f 89 + Jz +- def64 depM ++ def64 + + + +@@ -4044,7 +4186,7 @@ + oso + 0f 8a + Jz +- def64 depM ++ def64 + + + +@@ -4058,7 +4200,7 @@ + oso + 0f 8b + Jz +- def64 depM ++ def64 + + + +@@ -4072,7 +4214,7 @@ + oso + 0f 8c + Jz +- def64 depM ++ def64 + + + +@@ -4086,7 +4228,7 @@ + oso + 0f 8d + Jz +- def64 depM ++ def64 + + + +@@ -4100,7 +4242,7 @@ + oso + 0f 8e + Jz +- def64 depM ++ def64 + + + +@@ -4114,7 +4256,7 @@ + oso + 0f 8f + Jz +- def64 depM ++ def64 + + + +@@ -4151,28 +4293,28 @@ + aso oso rexw rexr rexx rexb + ff /reg=4 + Ev +- def64 depM ++ def64 + + + aso oso rexw rexr rexx rexb + ff /reg=5 +- Ep ++ Fv + + + oso + e9 + Jz +- def64 depM +- cast ++ def64 + + +- ea +- Ap +- inv64 ++ oso ++ ea /m=!64 ++ Av + + + eb + Jb ++ def64 + + + +@@ -4193,19 +4335,10 @@ + + + +- lddqu +- +- aso rexr rexx rexb +- ssef2 0f f0 +- V M +- +- +- +- + ldmxcsr + + aso rexw rexr rexx rexb +- 0f ae /reg=2 /mod=11 ++ 0f ae /reg=2 /mod=!11 + Md + + +@@ -4214,9 +4347,8 @@ + lds + + aso oso +- c5 ++ c5 /vex=none /m=!64 + Gv M +- inv64 + + + +@@ -4233,9 +4365,8 @@ + les + + aso oso +- c4 ++ c4 /m=!64 + Gv M +- inv64 + + + +@@ -4271,7 +4402,7 @@ + + aso oso rexw rexr rexx rexb + 0f b2 +- Gz M ++ Gv M + + + +@@ -4335,6 +4466,11 @@ + 0f 01 /reg=6 /mod=!11 + Ew + ++ ++ aso rexr rexx rexb ++ 0f 01 /reg=6 /mod=11 ++ Ew ++ + + + +@@ -4347,7 +4483,7 @@ + + lodsb + +- seg ++ rep seg + ac + + +@@ -4355,7 +4491,7 @@ + + lodsw + +- seg oso rexw ++ rep seg oso rexw + ad /o=16 + + +@@ -4363,7 +4499,7 @@ + + lodsd + +- seg oso rexw ++ rep seg oso rexw + ad /o=32 + + +@@ -4371,13 +4507,13 @@ + + lodsq + +- seg oso rexw ++ rep seg oso rexw + ad /o=64 + + + + +- loopnz ++ loopne + + e0 + Jb +@@ -4422,26 +4558,28 @@ + maskmovq + + aso rexr rexx rexb +- 0f f7 +- P PR ++ 0f f7 /mod=11 ++ P N + + + + + maxpd + +- aso rexr rexx rexb +- sse66 0f 5f +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 5f ++ V H W ++ sse2 avx + + + + + maxps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 5f +- V W ++ V H W ++ sse avx + + + +@@ -4449,8 +4587,9 @@ + maxsd + + aso rexr rexx rexb +- ssef2 0f 5f +- V W ++ /sse=f2 0f 5f ++ V H W ++ sse2 avx + + + +@@ -4458,8 +4597,9 @@ + maxss + + aso rexr rexx rexb +- ssef3 0f 5f +- V W ++ /sse=f3 0f 5f ++ V H W ++ sse avx + + + +@@ -4494,9 +4634,10 @@ + + minpd + +- aso rexr rexx rexb +- sse66 0f 5d +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 5d ++ V H W ++ sse2 avx + + + +@@ -4505,7 +4646,8 @@ + + aso rexr rexx rexb + 0f 5d +- V W ++ V H W ++ sse2 avx + + + +@@ -4513,8 +4655,9 @@ + minsd + + aso rexr rexx rexb +- ssef2 0f 5d +- V W ++ /sse=f2 0f 5d ++ V H MqU ++ sse2 avx + + + +@@ -4522,8 +4665,9 @@ + minss + + aso rexr rexx rexb +- ssef3 0f 5d +- V W ++ /sse=f3 0f 5d ++ V H MdU ++ sse avx + + + +@@ -4551,7 +4695,7 @@ + + aso oso rexw rexr rexx rexb + c7 /reg=0 +- Ev Iz ++ Ev sIz + + + aso rexr rexx rexb +@@ -4574,14 +4718,14 @@ + Gv Ev + + +- aso oso rexr rexx rexb ++ aso oso rexw rexr rexx rexb + 8c +- Ev S ++ MwRv S + + +- aso oso rexr rexx rexb ++ aso oso rexw rexr rexx rexb + 8e +- S Ev ++ S MwRv + + + a0 +@@ -4604,100 +4748,100 @@ + + rexb + b0 +- ALr8b Ib ++ R0b Ib + + + rexb + b1 +- CLr9b Ib ++ R1b Ib + + + rexb + b2 +- DLr10b Ib ++ R2b Ib + + + rexb + b3 +- BLr11b Ib ++ R3b Ib + + + rexb + b4 +- AHr12b Ib ++ R4b Ib + + + rexb + b5 +- CHr13b Ib ++ R5b Ib + + + rexb + b6 +- DHr14b Ib ++ R6b Ib + + + rexb + b7 +- BHr15b Ib ++ R7b Ib + + + oso rexw rexb + b8 +- rAXr8 Iv ++ R0v Iv + + + oso rexw rexb + b9 +- rCXr9 Iv ++ R1v Iv + + + oso rexw rexb + ba +- rDXr10 Iv ++ R2v Iv + + + oso rexw rexb + bb +- rBXr11 Iv ++ R3v Iv + + + oso rexw rexb + bc +- rSPr12 Iv ++ R4v Iv + + + oso rexw rexb + bd +- rBPr13 Iv ++ R5v Iv + + + oso rexw rexb + be +- rSIr14 Iv ++ R6v Iv + + + oso rexw rexb + bf +- rDIr15 Iv ++ R7v Iv + + +- rexr ++ rexr rexw rexb + 0f 20 + R C + + +- rexr ++ rexr rexw rexb + 0f 21 + R D + + +- rexr ++ rexr rexw rexb + 0f 22 + C R + + +- rexr ++ rexr rexw rexb + 0f 23 + D R + +@@ -4706,28 +4850,32 @@ + + movapd + +- aso rexr rexx rexb +- sse66 0f 28 ++ aso rexr rexx rexb vexl ++ /sse=66 0f 28 + V W ++ sse2 avx + + +- aso rexr rexx rexb +- sse66 0f 29 ++ aso rexr rexx rexb vexl ++ /sse=66 0f 29 + W V ++ sse2 avx + + + + + movaps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 28 + V W ++ sse avx + + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 29 + W V ++ sse avx + + + +@@ -4735,23 +4883,52 @@ + movd + + aso rexw rexr rexx rexb +- sse66 0f 6e +- V Ex ++ 0f 6e /o=16 ++ P Ey ++ mmx + + +- aso rexr rexx rexb +- 0f 6e +- P Ex ++ aso rexw rexr rexx rexb ++ 0f 6e /o=32 ++ P Ey ++ mmx + ++ + + aso rexw rexr rexx rexb +- sse66 0f 7e +- Ex V ++ /sse=66 0f 6e /o=16 ++ V Ey ++ sse2 avx + + +- aso rexr rexx rexb +- 0f 7e +- Ex P ++ aso rexw rexr rexx rexb ++ /sse=66 0f 6e /o=32 ++ V Ey ++ sse2 avx ++ ++ ++ aso rexw rexr rexx rexb ++ 0f 7e /o=16 ++ Ey P ++ mmx ++ ++ ++ aso rexw rexr rexx rexb ++ 0f 7e /o=32 ++ Ey P ++ mmx ++ ++ ++ aso rexw rexr rexx rexb ++ /sse=66 0f 7e /o=16 ++ Ey V ++ sse2 avx ++ ++ ++ aso rexw rexr rexx rexb ++ /sse=66 0f 7e /o=32 ++ Ey V ++ sse2 avx + + + +@@ -4759,13 +4936,15 @@ + movhpd + + aso rexr rexx rexb +- sse66 0f 16 /mod=!11 +- V M ++ /sse=66 0f 16 /mod=!11 ++ V H M ++ sse2 avx + + + aso rexr rexx rexb +- sse66 0f 17 ++ /sse=66 0f 17 + M V ++ sse2 avx + + + +@@ -4774,12 +4953,14 @@ + + aso rexr rexx rexb + 0f 16 /mod=!11 +- V M ++ V H M ++ sse avx + + + aso rexr rexx rexb + 0f 17 + M V ++ sse avx + + + +@@ -4788,7 +4969,8 @@ + + aso rexr rexx rexb + 0f 16 /mod=11 +- V VR ++ V H U ++ sse avx + + + +@@ -4796,14 +4978,15 @@ + movlpd + + aso rexr rexx rexb +- sse66 0f 12 /mod=!11 ++ /sse=66 0f 12 /mod=!11 + V M + + + aso rexr rexx rexb +- sse66 0f 13 ++ /sse=66 0f 13 + M V + ++ sse2 avx + + + +@@ -4818,6 +5001,7 @@ + 0f 13 + M V + ++ sse avx + + + +@@ -4825,16 +5009,18 @@ + + aso rexr rexx rexb + 0f 12 /mod=11 +- V VR ++ V U ++ sse avx + + + + + movmskpd + +- oso rexr rexb +- sse66 0f 50 +- Gd VR ++ oso rexr rexb vexl ++ /sse=66 0f 50 ++ Gd U ++ sse2 avx + + + +@@ -4843,16 +5029,18 @@ + + oso rexr rexb + 0f 50 +- Gd VR ++ Gd U ++ sse2 avx + + + + + movntdq + +- aso rexr rexx rexb +- sse66 0f e7 ++ aso rexr rexx rexb vexl ++ /sse=66 0f e7 + M V ++ sse2 avx + + + +@@ -4868,24 +5056,27 @@ + + movntpd + +- aso rexr rexx rexb +- sse66 0f 2b ++ aso rexr rexx rexb vexl ++ /sse=66 0f 2b + M V ++ sse2 avx + + + + + movntps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 2b + M V ++ sse2 avx + + + + + movntq + ++ aso rexr rexx rexb + 0f e7 + M P + +@@ -4894,31 +5085,59 @@ + + movq + +- aso rexr rexx rexb +- 0f 6f +- P Q ++ aso rexw rexr rexx rexb ++ 0f 6e /o=64 ++ P Eq ++ mmx + + +- aso rexr rexx rexb +- sse66 0f d6 +- W V ++ aso rexw rexr rexx rexb ++ /sse=66 0f 6e /o=64 ++ V Eq ++ sse2 avx + + +- aso rexr rexx rexb +- ssef3 0f 7e ++ aso rexw rexr rexx rexb ++ 0f 7e /o=64 ++ Eq P ++ mmx ++ ++ ++ aso rexw rexr rexx rexb ++ /sse=66 0f 7e /o=64 ++ Eq V ++ sse2 avx ++ ++ ++ aso rexw rexr rexx rexb ++ /sse=f3 0f 7e + V W ++ sse2 avx + + +- aso rexr rexx rexb ++ aso rexw rexr rexx rexb ++ /sse=66 0f d6 ++ W V ++ sse2 avx ++ ++ ++ aso rexw rexr rexx rexb ++ 0f 6f ++ P Q ++ mmx ++ ++ ++ aso rexw rexr rexx rexb + 0f 7f + Q P ++ mmx + + + + + movsb + +- seg ++ rep seg + a4 + + +@@ -4926,7 +5145,7 @@ + + movsw + +- seg oso rexw ++ rep seg oso rexw + a5 /o=16 + + +@@ -4934,25 +5153,27 @@ + + movsd + +- seg oso rexw ++ rep seg oso rexw + a5 /o=32 + + + aso rexr rexx rexb +- ssef2 0f 10 +- V W ++ /sse=f2 0f 10 ++ V MqU ++ sse2 + + + aso rexr rexx rexb +- ssef2 0f 11 ++ /sse=f2 0f 11 + W V ++ sse2 + + + + + movsq + +- seg oso rexw ++ rep seg oso rexw + a5 /o=64 + + +@@ -4961,13 +5182,15 @@ + movss + + aso rexr rexx rexb +- ssef3 0f 10 +- V W ++ /sse=f3 0f 10 ++ V MdU ++ sse + + + aso rexr rexx rexb +- ssef3 0f 11 ++ /sse=f3 0f 11 + W V ++ sse + + + +@@ -4981,35 +5204,39 @@ + + aso oso rexw rexr rexx rexb + 0f bf +- Gv Ew ++ Gy Ew + + + + + movupd + +- aso rexr rexx rexb +- sse66 0f 10 ++ aso rexr rexx rexb vexl ++ /sse=66 0f 10 + V W ++ sse2 avx + + +- aso rexr rexx rexb +- sse66 0f 11 ++ aso rexr rexx rexb vexl ++ /sse=66 0f 11 + W V ++ sse2 avx + + + + + movups + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 10 + V W ++ sse2 avx + + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 11 + W V ++ sse2 avx + + + +@@ -5023,7 +5250,7 @@ + + aso oso rexw rexr rexx rexb + 0f b7 +- Gv Ew ++ Gy Ew + + + +@@ -5044,18 +5271,20 @@ + + mulpd + +- aso rexr rexx rexb +- sse66 0f 59 +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 59 ++ V H W ++ sse2 avx + + + + + mulps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 59 +- V W ++ V H W ++ sse2 avx + + + +@@ -5063,8 +5292,9 @@ + mulsd + + aso rexr rexx rexb +- ssef2 0f 59 +- V W ++ /sse=f2 0f 59 ++ V H W ++ sse2 avx + + + +@@ -5072,8 +5302,9 @@ + mulss + + aso rexr rexx rexb +- ssef3 0f 59 +- V W ++ /sse=f3 0f 59 ++ V H W ++ sse avx + + + +@@ -5101,9 +5332,6 @@ + + nop + +- 90 +- +- + aso rexr rexx rexb + 0f 19 + M +@@ -5183,8 +5411,7 @@ + + oso rexw + 0d +- rAX Iz +- sext ++ rAX sIz + + + aso rexr rexx rexb +@@ -5194,38 +5421,37 @@ + + aso oso rexw rexr rexx rexb + 81 /reg=1 +- Ev Iz +- sext ++ Ev sIz + + + aso rexr rexx rexb +- 82 /reg=1 ++ 82 /reg=1 /m=!64 + Eb Ib +- inv64 + + + aso oso rexw rexr rexx rexb + 83 /reg=1 +- Ev Ib +- sext ++ Ev sIb + + + + + orpd + +- aso rexr rexx rexb +- sse66 0f 56 +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 56 ++ V H W ++ sse2 avx + + + + + orps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 56 +- V W ++ V H W ++ sse avx + + + +@@ -5254,6 +5480,7 @@ + + outsb + ++ rep seg + 6e + + +@@ -5261,7 +5488,7 @@ + + outsw + +- oso ++ rep oso seg + 6f /o=16 + + +@@ -5269,72 +5496,72 @@ + + outsd + +- oso ++ rep oso seg + 6f /o=32 + + + + +- outsq +- +- oso +- 6f /o=64 +- +- +- +- + packsswb + +- aso rexr rexx rexb +- sse66 0f 63 +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 63 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb + 0f 63 + P Q ++ mmx + + + + + packssdw + +- aso rexr rexx rexb +- sse66 0f 6b +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 6b ++ V H W ++ sse2 avx + + + aso rexr rexx rexb + 0f 6b + P Q ++ mmx + + + + + packuswb + +- aso rexr rexx rexb +- sse66 0f 67 +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 67 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb + 0f 67 + P Q ++ mmx + + + + + paddb + +- aso rexr rexx rexb +- sse66 0f fc +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f fc ++ V H W ++ sse2 avx + + + aso rexr rexx rexb + 0f fc + P Q ++ mmx + + + +@@ -5344,11 +5571,13 @@ + aso rexr rexx rexb + 0f fd + P Q ++ mmx + + +- aso rexr rexx rexb +- sse66 0f fd +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f fd ++ V H W ++ sse2 avx + + + +@@ -5358,11 +5587,13 @@ + aso rexr rexx rexb + 0f fe + P Q ++ mmx + + +- aso rexr rexx rexb +- sse66 0f fe +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f fe ++ V H W ++ sse2 avx + + + +@@ -5376,8 +5607,9 @@ + + + aso rexr rexx rexb +- sse66 0f ec +- V W ++ /sse=66 0f ec ++ V H W ++ sse2 avx + + + +@@ -5390,8 +5622,9 @@ + + + aso rexr rexx rexb +- sse66 0f ed +- V W ++ /sse=66 0f ed ++ V H W ++ sse2 avx + + + +@@ -5404,8 +5637,9 @@ + + + aso rexr rexx rexb +- sse66 0f dc +- V W ++ /sse=66 0f dc ++ V H W ++ sse2 avx + + + +@@ -5418,8 +5652,9 @@ + + + aso rexr rexx rexb +- sse66 0f dd +- V W ++ /sse=66 0f dd ++ V H W ++ sse2 avx + + + +@@ -5427,8 +5662,9 @@ + pand + + aso rexr rexx rexb +- sse66 0f db +- V W ++ /sse=66 0f db ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5441,8 +5677,9 @@ + pandn + + aso rexr rexx rexb +- sse66 0f df +- V W ++ /sse=66 0f df ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5455,8 +5692,9 @@ + pavgb + + aso rexr rexx rexb +- sse66 0f e0 +- V W ++ /sse=66 0f e0 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5469,8 +5707,9 @@ + pavgw + + aso rexr rexx rexb +- sse66 0f e3 +- V W ++ /sse=66 0f e3 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5488,8 +5727,9 @@ + + + aso rexr rexx rexb +- sse66 0f 74 +- V W ++ /sse=66 0f 74 ++ V H W ++ sse2 avx + + + +@@ -5502,8 +5742,9 @@ + + + aso rexr rexx rexb +- sse66 0f 75 +- V W ++ /sse=66 0f 75 ++ V H W ++ sse2 avx + + + +@@ -5516,8 +5757,9 @@ + + + aso rexr rexx rexb +- sse66 0f 76 +- V W ++ /sse=66 0f 76 ++ V H W ++ sse2 avx + + + +@@ -5525,8 +5767,9 @@ + pcmpgtb + + aso rexr rexx rexb +- sse66 0f 64 +- V W ++ /sse=66 0f 64 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5539,8 +5782,9 @@ + pcmpgtw + + aso rexr rexx rexb +- sse66 0f 65 +- V W ++ /sse=66 0f 65 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5553,8 +5797,9 @@ + pcmpgtd + + aso rexr rexx rexb +- sse66 0f 66 +- V W ++ /sse=66 0f 66 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5566,24 +5811,27 @@ + + pextrb + +- aso rexr rexb +- sse66 0f 3a 14 ++ aso rexx rexr rexb ++ /sse=66 0f 3a 14 /vexw=0 + MbRv V Ib + def64 ++ sse4.1 avx + + + + + pextrd + +- aso rexr rexw rexb +- sse66 0f 3a 16 /o=16 +- Ev V Ib ++ aso rexr rexx rexw rexb ++ /sse=66 0f 3a 16 /o=16 /vexw=0 ++ Ed V Ib ++ sse4.1 avx + + +- aso rexr rexw rexb +- sse66 0f 3a 16 /o=32 +- Ev V Ib ++ aso rexr rexx rexw rexb ++ /sse=66 0f 3a 16 /o=32 /vexw=0 ++ Ed V Ib ++ sse4.1 avx + + + +@@ -5591,40 +5839,126 @@ + pextrq + + aso rexr rexw rexb +- sse66 0f 3a 16 /o=64 +- Ev V Ib ++ /sse=66 0f 3a 16 /o=64 /vexw=1 ++ Eq V Ib + def64 ++ sse4.1 avx + + + + + pextrw + +- aso rexr rexb +- sse66 0f c5 +- Gd VR Ib ++ aso rexw rexr rexb ++ /sse=66 0f c5 ++ Gd U Ib ++ sse avx + + +- aso oso rexw rexr rexx rexb ++ aso rexw rexr rexx rexb + 0f c5 +- Gd PR Ib ++ Gd N Ib ++ ++ ++ aso rexw rexx rexr rexb ++ /sse=66 0f 3a 15 ++ MwRd V Ib ++ sse4.1 avx ++ ++ ++ ++ ++ pinsrb ++ ++ aso rexw rexr rexx rexb ++ /sse=66 0f 3a 20 ++ V MbRd Ib ++ sse4.1 + + + + + pinsrw + +- aso oso rexw rexr rexx rexb ++ aso rexw rexr rexx rexb + 0f c4 +- P Ew Ib ++ P MwRy Ib ++ def64 + + + aso rexw rexr rexx rexb +- sse66 0f c4 +- V Ew Ib ++ /sse=66 0f c4 ++ V MwRy Ib ++ def64 ++ sse2 avx ++ ++ ++ ++ ++ pinsrd ++ ++ aso rexw rexr rexx rexb ++ /sse=66 0f 3a 22 /o=16 ++ V Ed Ib ++ sse4.1 ++ ++ ++ ++ aso rexw rexr rexx rexb ++ /sse=66 0f 3a 22 /o=32 ++ V Ed Ib ++ sse4.1 ++ ++ ++ ++ ++ pinsrq ++ ++ aso oso rexw rexr rexx rexb ++ /sse=66 0f 3a 22 /o=64 ++ V Eq Ib ++ sse4.1 ++ ++ ++ ++ ++ vpinsrb ++ ++ aso rexw rexr rexx rexb ++ /vex=66_0f3a 20 /vexw=0 /vexl=0 ++ V H MbRd Ib ++ avx ++ ++ ++ ++ ++ vpinsrd ++ ++ aso oso rexw rexr rexx rexb ++ /vex=66_0f3a 22 /m=!64 /vexw=0 /vexl=0 ++ V H Ed Ib ++ avx ++ ++ ++ aso oso rexw rexr rexx rexb ++ /vex=66_0f3a 22 /m=64 /vexw=0 /vexl=0 ++ V H Ed Ib ++ avx ++ ++ ++ ++ ++ ++ vpinsrq ++ ++ aso oso rexw rexr rexx rexb ++ /vex=66_0f3a 22 /m=64 /vexw=1 /vexl=0 ++ V H Eq Ib ++ avx + + + ++ + + pmaddwd + +@@ -5634,8 +5968,9 @@ + + + aso rexr rexx rexb +- sse66 0f f5 +- V W ++ /sse=66 0f f5 ++ V H W ++ sse4.1 avx + + + +@@ -5643,8 +5978,9 @@ + pmaxsw + + aso rexr rexx rexb +- sse66 0f ee +- V W ++ /sse=66 0f ee ++ V H W ++ sse4.1 avx + + + aso rexr rexx rexb +@@ -5662,8 +5998,9 @@ + + + aso rexr rexx rexb +- sse66 0f de +- V W ++ /sse=66 0f de ++ V H W ++ sse2 avx + + + +@@ -5671,8 +6008,9 @@ + pminsw + + aso rexr rexx rexb +- sse66 0f ea +- V W ++ /sse=66 0f ea ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5685,8 +6023,9 @@ + pminub + + aso rexr rexx rexb +- sse66 0f da +- V W ++ /sse=66 0f da ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5698,14 +6037,15 @@ + + pmovmskb + +- rexr rexb +- sse66 0f d7 +- Gd VR ++ oso rexr rexw rexb ++ /sse=66 0f d7 /vexl=0 ++ Gd U ++ sse2 avx + + +- oso rexr rexb ++ oso rexr rexw rexb + 0f d7 +- Gd PR ++ Gd N + + + +@@ -5718,8 +6058,9 @@ + + + aso rexr rexx rexb +- sse66 0f e4 +- V W ++ /sse=66 0f e4 ++ V H W ++ sse2 avx + + + +@@ -5727,8 +6068,9 @@ + pmulhw + + aso rexr rexx rexb +- sse66 0f e5 +- V W ++ /sse=66 0f e5 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5746,25 +6088,26 @@ + + + aso rexr rexx rexb +- sse66 0f d5 +- V W ++ /sse=66 0f d5 ++ V H W ++ sse2 avx + + + + + pop + +- 07 ++ 07 /m=!64 + ES + inv64 + + +- 17 ++ 17 /m=!64 + SS + inv64 + + +- 1f ++ 1f /m=!64 + DS + inv64 + +@@ -5779,56 +6122,56 @@ + + oso rexb + 58 +- rAXr8 +- def64 depM ++ R0v ++ def64 + + + oso rexb + 59 +- rCXr9 +- def64 depM ++ R1v ++ def64 + + + oso rexb + 5a +- rDXr10 +- def64 depM ++ R2v ++ def64 + + + oso rexb + 5b +- rBXr11 +- def64 depM ++ R3v ++ def64 + + + oso rexb + 5c +- rSPr12 +- def64 depM ++ R4v ++ def64 + + + oso rexb + 5d +- rBPr13 +- def64 depM ++ R5v ++ def64 + + + oso rexb + 5e +- rSIr14 +- def64 depM ++ R6v ++ def64 + + + oso rexb + 5f +- rDIr15 +- def64 depM ++ R7v ++ def64 + + + aso oso rexw rexr rexx rexb + 8f /reg=0 + Ev +- def64 depM ++ def64 + + + +@@ -5836,7 +6179,7 @@ + popa + + oso +- 61 /o=16 ++ 61 /o=16 /m=!64 + inv64 + + +@@ -5845,7 +6188,7 @@ + popad + + oso +- 61 /o=32 ++ 61 /o=32 /m=!64 + inv64 + + +@@ -5854,13 +6197,7 @@ + popfw + + oso +- 9d /m=32 /o=16 +- def64 depM +- +- +- oso +- 9d /m=16 /o=16 +- def64 depM ++ 9d /m=!64 /o=16 + + + +@@ -5868,13 +6205,7 @@ + popfd + + oso +- 9d /m=16 /o=32 +- def64 depM +- +- +- oso +- 9d /m=32 /o=32 +- def64 depM ++ 9d /m=!64 /o=32 + + + +@@ -5882,8 +6213,13 @@ + popfq + + oso ++ 9d /m=64 /o=32 ++ def64 ++ ++ ++ oso + 9d /m=64 /o=64 +- def64 depM ++ def64 + + + +@@ -5891,8 +6227,9 @@ + por + + aso rexr rexx rexb +- sse66 0f eb +- V W ++ /sse=66 0f eb ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -5985,8 +6322,9 @@ + psadbw + + aso rexr rexx rexb +- sse66 0f f6 +- V W ++ /sse=66 0f f6 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6004,12 +6342,13 @@ + + + +- ++ + psllw + + aso rexr rexx rexb +- sse66 0f f1 ++ /sse=66 0f f1 + V W ++ sse2 + + + aso rexr rexx rexb +@@ -6018,12 +6357,13 @@ + + + rexb +- sse66 0f 71 /reg=6 +- VR Ib ++ /sse=66 0f 71 /reg=6 ++ U Ib ++ sse2 + + + 0f 71 /reg=6 +- PR Ib ++ N Ib + + + +@@ -6031,8 +6371,9 @@ + pslld + + aso rexr rexx rexb +- sse66 0f f2 ++ /sse=66 0f f2 + V W ++ sse2 + + + aso rexr rexx rexb +@@ -6041,12 +6382,13 @@ + + + rexb +- sse66 0f 72 /reg=6 +- VR Ib ++ /sse=66 0f 72 /reg=6 ++ U Ib ++ sse2 + + + 0f 72 /reg=6 +- PR Ib ++ N Ib + + + +@@ -6054,8 +6396,9 @@ + psllq + + aso rexr rexx rexb +- sse66 0f f3 ++ /sse=66 0f f3 + V W ++ sse2 + + + aso rexr rexx rexb +@@ -6064,12 +6407,13 @@ + + + rexb +- sse66 0f 73 /reg=6 +- VR Ib ++ /sse=66 0f 73 /reg=6 ++ U Ib ++ sse2 + + + 0f 73 /reg=6 +- PR Ib ++ N Ib + + + +@@ -6082,17 +6426,19 @@ + + + aso rexr rexx rexb +- sse66 0f e1 +- V W ++ /sse=66 0f e1 ++ V H W ++ sse2 avx + + + rexb +- sse66 0f 71 /reg=4 +- VR Ib ++ /sse=66 0f 71 /reg=4 ++ H U Ib ++ sse2 avx + + + 0f 71 /reg=4 +- PR Ib ++ N Ib + + + +@@ -6100,12 +6446,13 @@ + psrad + + 0f 72 /reg=4 +- PR Ib ++ N Ib + + + aso rexr rexx rexb +- sse66 0f e2 +- V W ++ /sse=66 0f e2 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6114,8 +6461,9 @@ + + + rexb +- sse66 0f 72 /reg=4 +- VR Ib ++ /sse=66 0f 72 /reg=4 ++ H U Ib ++ sse2 avx + + + +@@ -6123,7 +6471,7 @@ + psrlw + + 0f 71 /reg=2 +- PR Ib ++ N Ib + + + aso rexr rexx rexb +@@ -6132,13 +6480,15 @@ + + + aso rexr rexx rexb +- sse66 0f d1 +- V W ++ /sse=66 0f d1 ++ V H W ++ sse2 avx + + + rexb +- sse66 0f 71 /reg=2 +- VR Ib ++ /sse=66 0f 71 /reg=2 ++ H U Ib ++ sse2 avx + + + +@@ -6146,7 +6496,7 @@ + psrld + + 0f 72 /reg=2 +- PR Ib ++ N Ib + + + aso rexr rexx rexb +@@ -6155,13 +6505,15 @@ + + + aso rexr rexx rexb +- sse66 0f d2 +- V W ++ /sse=66 0f d2 ++ V H W ++ sse2 avx + + + rexb +- sse66 0f 72 /reg=2 +- VR Ib ++ /sse=66 0f 72 /reg=2 ++ H U Ib ++ sse2 avx + + + +@@ -6169,7 +6521,7 @@ + psrlq + + 0f 73 /reg=2 +- PR Ib ++ N Ib + + + aso rexr rexx rexb +@@ -6178,13 +6530,15 @@ + + + aso rexr rexx rexb +- sse66 0f d3 +- V W ++ /sse=66 0f d3 ++ V H W ++ sse2 avx + + + rexb +- sse66 0f 73 /reg=2 +- VR Ib ++ /sse=66 0f 73 /reg=2 ++ H U Ib ++ sse2 avx + + + +@@ -6192,8 +6546,9 @@ + psubb + + aso rexr rexx rexb +- sse66 0f f8 +- V W ++ /sse=66 0f f8 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6206,8 +6561,9 @@ + psubw + + aso rexr rexx rexb +- sse66 0f f9 +- V W ++ /sse=66 0f f9 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6225,8 +6581,9 @@ + + + aso rexr rexx rexb +- sse66 0f fa +- V W ++ /sse=66 0f fa ++ V H W ++ sse2 avx + + + +@@ -6239,8 +6596,9 @@ + + + aso rexr rexx rexb +- sse66 0f e8 +- V W ++ /sse=66 0f e8 ++ V H W ++ sse2 avx + + + +@@ -6253,8 +6611,9 @@ + + + aso rexr rexx rexb +- sse66 0f e9 +- V W ++ /sse=66 0f e9 ++ V H W ++ sse2 avx + + + +@@ -6267,8 +6626,9 @@ + + + aso rexr rexx rexb +- sse66 0f d8 +- V W ++ /sse=66 0f d8 ++ V H W ++ sse2 avx + + + +@@ -6281,8 +6641,9 @@ + + + aso rexr rexx rexb +- sse66 0f d9 +- V W ++ /sse=66 0f d9 ++ V H W ++ sse2 avx + + + +@@ -6290,8 +6651,9 @@ + punpckhbw + + aso rexr rexx rexb +- sse66 0f 68 +- V W ++ /sse=66 0f 68 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6304,8 +6666,9 @@ + punpckhwd + + aso rexr rexx rexb +- sse66 0f 69 +- V W ++ /sse=66 0f 69 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6318,8 +6681,9 @@ + punpckhdq + + aso rexr rexx rexb +- sse66 0f 6a +- V W ++ /sse=66 0f 6a ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6332,8 +6696,9 @@ + punpcklbw + + aso rexr rexx rexb +- sse66 0f 60 +- V W ++ /sse=66 0f 60 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6346,8 +6711,9 @@ + punpcklwd + + aso rexr rexx rexb +- sse66 0f 61 +- V W ++ /sse=66 0f 61 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6360,8 +6726,9 @@ + punpckldq + + aso rexr rexx rexb +- sse66 0f 62 +- V W ++ /sse=66 0f 62 ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6373,6 +6740,7 @@ + + pi2fw + ++ aso rexr rexx rexb + 0f 0f /3dnow=0c + P Q + +@@ -6381,6 +6749,7 @@ + + pi2fd + ++ aso rexr rexx rexb + 0f 0f /3dnow=0d + P Q + +@@ -6389,6 +6758,7 @@ + + pf2iw + ++ aso rexr rexx rexb + 0f 0f /3dnow=1c + P Q + +@@ -6397,6 +6767,7 @@ + + pf2id + ++ aso rexr rexx rexb + 0f 0f /3dnow=1d + P Q + +@@ -6405,6 +6776,7 @@ + + pfnacc + ++ aso rexr rexx rexb + 0f 0f /3dnow=8a + P Q + +@@ -6413,6 +6785,7 @@ + + pfpnacc + ++ aso rexr rexx rexb + 0f 0f /3dnow=8e + P Q + +@@ -6421,6 +6794,7 @@ + + pfcmpge + ++ aso rexr rexx rexb + 0f 0f /3dnow=90 + P Q + +@@ -6429,6 +6803,7 @@ + + pfmin + ++ aso rexr rexx rexb + 0f 0f /3dnow=94 + P Q + +@@ -6437,6 +6812,7 @@ + + pfrcp + ++ aso rexr rexx rexb + 0f 0f /3dnow=96 + P Q + +@@ -6445,6 +6821,7 @@ + + pfrsqrt + ++ aso rexr rexx rexb + 0f 0f /3dnow=97 + P Q + +@@ -6453,6 +6830,7 @@ + + pfsub + ++ aso rexr rexx rexb + 0f 0f /3dnow=9a + P Q + +@@ -6461,6 +6839,7 @@ + + pfadd + ++ aso rexr rexx rexb + 0f 0f /3dnow=9e + P Q + +@@ -6469,6 +6848,7 @@ + + pfcmpgt + ++ aso rexr rexx rexb + 0f 0f /3dnow=a0 + P Q + +@@ -6477,6 +6857,7 @@ + + pfmax + ++ aso rexr rexx rexb + 0f 0f /3dnow=a4 + P Q + +@@ -6485,6 +6866,7 @@ + + pfrcpit1 + ++ aso rexr rexx rexb + 0f 0f /3dnow=a6 + P Q + +@@ -6493,6 +6875,7 @@ + + pfrsqit1 + ++ aso rexr rexx rexb + 0f 0f /3dnow=a7 + P Q + +@@ -6501,6 +6884,7 @@ + + pfsubr + ++ aso rexr rexx rexb + 0f 0f /3dnow=aa + P Q + +@@ -6509,6 +6893,7 @@ + + pfacc + ++ aso rexr rexx rexb + 0f 0f /3dnow=ae + P Q + +@@ -6517,6 +6902,7 @@ + + pfcmpeq + ++ aso rexr rexx rexb + 0f 0f /3dnow=b0 + P Q + +@@ -6525,6 +6911,7 @@ + + pfmul + ++ aso rexr rexx rexb + 0f 0f /3dnow=b4 + P Q + +@@ -6533,6 +6920,7 @@ + + pfrcpit2 + ++ aso rexr rexx rexb + 0f 0f /3dnow=b6 + P Q + +@@ -6541,6 +6929,7 @@ + + pmulhrw + ++ aso rexr rexx rexb + 0f 0f /3dnow=b7 + P Q + +@@ -6549,6 +6938,7 @@ + + pswapd + ++ aso rexr rexx rexb + 0f 0f /3dnow=bb + P Q + +@@ -6557,6 +6947,7 @@ + + pavgusb + ++ aso rexr rexx rexb + 0f 0f /3dnow=bf + P Q + +@@ -6565,22 +6956,22 @@ + + push + +- 06 ++ 06 /m=!64 + ES + inv64 + + +- 0e ++ 0e /m=!64 + CS + inv64 + + +- 16 ++ 16 /m=!64 + SS + inv64 + + +- 1e ++ 1e /m=!64 + DS + inv64 + +@@ -6595,56 +6986,56 @@ + + oso rexb + 50 +- rAXr8 +- def64 depM ++ R0v ++ def64 + + + oso rexb + 51 +- rCXr9 +- def64 depM ++ R1v ++ def64 + + + oso rexb + 52 +- rDXr10 +- def64 depM ++ R2v ++ def64 + + + oso rexb + 53 +- rBXr11 +- def64 depM ++ R3v ++ def64 + + + oso rexb + 54 +- rSPr12 +- def64 depM ++ R4v ++ def64 + + + oso rexb + 55 +- rBPr13 +- def64 depM ++ R5v ++ def64 + + + oso rexb + 56 +- rSIr14 +- def64 depM ++ R6v ++ def64 + + + oso rexb + 57 +- rDIr15 +- def64 depM ++ R7v ++ def64 + + + oso + 68 +- Iz +- cast ++ sIz ++ def64 + + + aso oso rexw rexr rexx rexb +@@ -6653,9 +7044,10 @@ + def64 + + ++ oso + 6a +- Ib +- sext ++ sIb ++ def64 + + + +@@ -6663,7 +7055,7 @@ + pusha + + oso +- 60 /o=16 ++ 60 /o=16 /m=!64 + inv64 + + +@@ -6672,7 +7064,7 @@ + pushad + + oso +- 60 /o=32 ++ 60 /o=32 /m=!64 + inv64 + + +@@ -6681,13 +7073,7 @@ + pushfw + + oso +- 9c /m=32 /o=16 +- def64 +- +- +- oso +- 9c /m=16 /o=16 +- def64 ++ 9c /m=!64 /o=16 + + + oso rexw +@@ -6700,13 +7086,7 @@ + pushfd + + oso +- 9c /m=16 /o=32 +- def64 +- +- +- oso +- 9c /m=32 /o=32 +- def64 ++ 9c /m=!64 /o=32 + + + +@@ -6728,8 +7108,9 @@ + pxor + + aso rexr rexx rexb +- sse66 0f ef +- V W ++ /sse=66 0f ef ++ V H W ++ sse2 avx + + + aso rexr rexx rexb +@@ -6759,13 +7140,11 @@ + aso rexw rexr rexx rexb + d2 /reg=2 + Eb CL +- cast + + + aso oso rexw rexr rexx rexb + d3 /reg=2 + Ev CL +- cast + + + aso oso rexw rexr rexx rexb +@@ -6800,13 +7179,11 @@ + aso rexw rexr rexx rexb + d2 /reg=3 + Eb CL +- cast + + + aso oso rexw rexr rexx rexb + d3 /reg=3 + Ev CL +- cast + + + +@@ -6831,13 +7208,11 @@ + aso rexw rexr rexx rexb + d2 /reg=0 + Eb CL +- cast + + + aso oso rexw rexr rexx rexb + d3 /reg=0 + Ev CL +- cast + + + aso oso rexw rexr rexx rexb +@@ -6872,22 +7247,21 @@ + aso rexw rexr rexx rexb + d2 /reg=1 + Eb CL +- cast + + + aso oso rexw rexr rexx rexb + d3 /reg=1 + Ev CL +- cast + + + + + rcpps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 53 + V W ++ sse avx + + + +@@ -6895,8 +7269,9 @@ + rcpss + + aso rexr rexx rexb +- ssef3 0f 53 ++ /sse=f3 0f 53 + V W ++ sse avx + + + +@@ -6975,9 +7350,10 @@ + + rsqrtps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 52 + V W ++ sse avx + + + +@@ -6985,8 +7361,9 @@ + rsqrtss + + aso rexr rexx rexb +- ssef3 0f 52 ++ /sse=f3 0f 52 + V W ++ sse avx + + + +@@ -7004,7 +7381,7 @@ + + salc + +- d6 ++ d6 /m=!64 + inv64 + + +@@ -7035,13 +7412,11 @@ + aso rexw rexr rexx rexb + d2 /reg=7 + Eb CL +- cast + + + aso oso rexw rexr rexx rexb + d3 /reg=7 + Ev CL +- cast + + + +@@ -7066,13 +7441,11 @@ + aso rexw rexr rexx rexb + d2 /reg=6 + Eb CL +- cast + + + aso oso rexw rexr rexx rexb + d3 /reg=6 + Ev CL +- cast + + + aso oso rexw rexr rexx rexb +@@ -7083,7 +7456,6 @@ + aso rexr rexx rexb + d2 /reg=4 + Eb CL +- cast + + + aso oso rexw rexr rexx rexb +@@ -7123,7 +7495,6 @@ + aso rexw rexr rexx rexb + d2 /reg=5 + Eb CL +- cast + + + aso oso rexw rexr rexx rexb +@@ -7144,7 +7515,6 @@ + aso oso rexw rexr rexx rexb + d3 /reg=5 + Ev CL +- cast + + + +@@ -7177,8 +7547,7 @@ + + oso rexw + 1d +- rAX Iz +- sext ++ rAX sIz + + + aso rexr rexx rexb +@@ -7188,26 +7557,25 @@ + + aso oso rexw rexr rexx rexb + 81 /reg=3 +- Ev Iz +- sext ++ Ev sIz + + + aso rexr rexx rexb +- 82 /reg=3 ++ 82 /reg=3 /m=!64 + Eb Ib + inv64 + + + aso oso rexw rexr rexx rexb + 83 /reg=3 +- Ev Ib +- sext ++ Ev sIb + + + + + scasb + ++ repz + ae + + +@@ -7215,7 +7583,7 @@ + + scasw + +- oso rexw ++ repz oso rexw + af /o=16 + + +@@ -7223,7 +7591,7 @@ + + scasd + +- oso rexw ++ repz oso rexw + af /o=32 + + +@@ -7231,7 +7599,7 @@ + + scasq + +- oso rexw ++ repz oso rexw + af /o=64 + + +@@ -7264,7 +7632,7 @@ + + + +- setnb ++ setae + + aso rexr rexx rexb + 0f 93 +@@ -7448,9 +7816,10 @@ + + shufpd + +- aso rexr rexx rexb +- sse66 0f c6 +- V W Ib ++ aso rexr rexx rexb vexl ++ /sse=66 0f c6 ++ V H W Ib ++ sse2 avx + + + +@@ -7459,7 +7828,8 @@ + + aso rexr rexx rexb + 0f c6 +- V W Ib ++ V H W Ib ++ sse2 avx + + + +@@ -7475,7 +7845,7 @@ + + sldt + +- aso oso rexr rexx rexb ++ aso oso rexr rexw rexx rexb + 0f 00 /reg=0 + MwRv + +@@ -7484,18 +7854,24 @@ + + smsw + +- aso rexr rexx rexb ++ aso oso rexr rexw rexx rexb + 0f 01 /reg=4 /mod=!11 +- M ++ MwRv ++ ++ ++ aso oso rexr rexw rexx rexb ++ 0f 01 /reg=4 /mod=11 ++ MwRv + + + + + sqrtps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 51 + V W ++ sse avx + + + +@@ -7503,8 +7879,9 @@ + sqrtpd + + aso rexr rexx rexb +- sse66 0f 51 ++ /sse=66 0f 51 + V W ++ sse2 avx + + + +@@ -7512,8 +7889,9 @@ + sqrtsd + + aso rexr rexx rexb +- ssef2 0f 51 +- V W ++ /sse=f2 0f 51 ++ V H W ++ sse2 avx + + + +@@ -7521,8 +7899,9 @@ + sqrtss + + aso rexr rexx rexb +- ssef3 0f 51 +- V W ++ /sse=f3 0f 51 ++ V H W ++ sse avx + + + +@@ -7567,15 +7946,16 @@ + stmxcsr + + aso rexw rexr rexx rexb +- 0f ae /mod=11 /reg=3 ++ 0f ae /mod=!11 /reg=3 + Md ++ sse avx + + + + + stosb + +- seg ++ rep seg + aa + + +@@ -7583,7 +7963,7 @@ + + stosw + +- seg oso rexw ++ rep seg oso rexw + ab /o=16 + + +@@ -7591,7 +7971,7 @@ + + stosd + +- seg oso rexw ++ rep seg oso rexw + ab /o=32 + + +@@ -7599,7 +7979,7 @@ + + stosq + +- seg oso rexw ++ rep seg oso rexw + ab /o=64 + + +@@ -7607,9 +7987,9 @@ + + str + +- aso oso rexr rexx rexb ++ aso oso rexr rexw rexx rexb + 0f 00 /reg=1 +- Ev ++ MwRv + + + +@@ -7642,8 +8022,7 @@ + + oso rexw + 2d +- rAX Iz +- sext ++ rAX sIz + + + aso rexr rexx rexb +@@ -7653,38 +8032,38 @@ + + aso oso rexw rexr rexx rexb + 81 /reg=5 +- Ev Iz +- sext ++ Ev sIz + + + aso rexr rexx rexb +- 82 /reg=5 ++ 82 /reg=5 /m=!64 + Eb Ib + inv64 + + + aso oso rexw rexr rexx rexb + 83 /reg=5 +- Ev Ib +- sext ++ Ev sIb + + + + + subpd + +- aso rexr rexx rexb +- sse66 0f 5c +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 5c ++ V H W ++ sse2 avx + + + + + subps + +- aso rexr rexx rexb ++ aso rexr rexx rexb vexl + 0f 5c +- V W ++ V H W ++ sse avx + + + +@@ -7692,8 +8071,9 @@ + subsd + + aso rexr rexx rexb +- ssef2 0f 5c +- V W ++ /sse=f2 0f 5c ++ V H W ++ sse2 avx + + + +@@ -7701,8 +8081,9 @@ + subss + + aso rexr rexx rexb +- ssef3 0f 5c +- V W ++ /sse=f3 0f 5c ++ V H W ++ sse avx + + + +@@ -7723,15 +8104,22 @@ + + sysenter + +- 0f 34 +- inv64 ++ 0f 34 /m=!64 ++ ++ ++ 0f 34 /m=64 ++ intel + + + + + sysexit + +- 0f 35 ++ 0f 35 /m=!64 ++ ++ ++ 0f 35 /m=64 ++ intel + + + +@@ -7766,8 +8154,7 @@ + + oso rexw + a9 +- rAX Iz +- sext ++ rAX sIz + + + aso rexw rexr rexx rexb +@@ -7777,14 +8164,12 @@ + + aso oso rexw rexr rexx rexb + f7 /reg=0 +- Ev Iz +- sext ++ Ev sIz + + + aso oso rexw rexr rexx rexb + f7 /reg=1 + Ev Iz +- sext + + + +@@ -7792,8 +8177,9 @@ + ucomisd + + aso rexr rexx rexb +- sse66 0f 2e ++ /sse=66 0f 2e + V W ++ sse2 avx + + + +@@ -7803,6 +8189,7 @@ + aso rexr rexx rexb + 0f 2e + V W ++ sse avx + + + +@@ -7816,9 +8203,10 @@ + + unpckhpd + +- aso rexr rexx rexb +- sse66 0f 15 +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 15 ++ V H W ++ sse2 avx + + + +@@ -7827,7 +8215,8 @@ + + aso rexr rexx rexb + 0f 15 +- V W ++ V H W ++ sse avx + + + +@@ -7836,16 +8225,18 @@ + + aso rexr rexx rexb + 0f 14 +- V W ++ V H W ++ sse avx + + + + + unpcklpd + +- aso rexr rexx rexb +- sse66 0f 14 +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 14 ++ V H W ++ sse2 avx + + + +@@ -7876,11 +8267,21 @@ + + + ++ rdrand ++ ++ oso rexr rexw rexx rexb ++ 0f c7 /mod=11 /reg=6 ++ R ++ ++ rdrand ++ ++ ++ + vmclear + intel + + aso rexr rexx rexb +- sse66 0f c7 /reg=6 ++ /sse=66 0f c7 /mod=!11 /reg=6 + Mq + + +@@ -7890,7 +8291,7 @@ + intel + + aso rexr rexx rexb +- ssef3 0f c7 /reg=6 ++ /sse=f3 0f c7 /mod=!11 /reg=6 + Mq + + +@@ -7900,7 +8301,7 @@ + intel + + aso rexr rexx rexb +- 0f c7 /reg=6 ++ 0f c7 /mod=!11 /reg=6 + Mq + + +@@ -7910,7 +8311,7 @@ + intel + + aso rexr rexx rexb +- 0f c7 /reg=7 ++ 0f c7 /mod=!11 /reg=7 + Mq + + +@@ -7944,20 +8345,8 @@ + intel + + aso rexr rexx rexb +- 0f 78 /m=16 +- Ed Gd +- def64 +- +- +- aso rexr rexx rexb +- 0f 78 /m=32 +- Ed Gd +- def64 +- +- +- aso rexr rexx rexb +- 0f 78 /m=64 +- Eq Gq ++ 0f 78 ++ Ey Gy + def64 + + +@@ -7967,20 +8356,8 @@ + intel + + aso rexr rexx rexb +- 0f 79 /m=16 +- Gd Ed +- def64 +- +- +- aso rexr rexx rexb +- 0f 79 /m=32 +- Gd Ed +- def64 +- +- +- aso rexr rexx rexb +- 0f 79 /m=64 +- Gq Eq ++ 0f 79 ++ Gy Ey + def64 + + +@@ -8067,49 +8444,56 @@ + + oso rexw rexb + 90 +- rAXr8 rAX ++ R0v rAX + + + oso rexw rexb + 91 +- rCXr9 rAX ++ R1v rAX + + + oso rexw rexb + 92 +- rDXr10 rAX ++ R2v rAX + + + oso rexw rexb + 93 +- rBXr11 rAX ++ R3v rAX + + + oso rexw rexb + 94 +- rSPr12 rAX ++ R4v rAX + + + oso rexw rexb + 95 +- rBPr13 rAX ++ R5v rAX + + + oso rexw rexb + 96 +- rSIr14 rAX ++ R6v rAX + + + oso rexw rexb + 97 +- rDIr15 rAX ++ R7v rAX + + + + ++ xgetbv ++ ++ 0f 01 /mod=11 /reg=2 /rm=0 ++ ++ ++ ++ + xlatb + +- rexw ++ rexw seg + d7 + + +@@ -8143,8 +8527,7 @@ + + oso rexw + 35 +- rAX Iz +- sext ++ rAX sIz + + + aso rexr rexx rexb +@@ -8154,29 +8537,28 @@ + + aso oso rexw rexr rexx rexb + 81 /reg=6 +- Ev Iz +- sext ++ Ev sIz + + + aso rexr rexx rexb +- 82 /reg=6 ++ 82 /reg=6 /m=!64 + Eb Ib + inv64 + + + aso oso rexw rexr rexx rexb + 83 /reg=6 +- Ev Ib +- sext ++ Ev sIb + + + + + xorpd + +- aso rexr rexx rexb +- sse66 0f 57 +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 57 ++ V H W ++ sse2 avx + + + +@@ -8185,7 +8567,8 @@ + + aso rexr rexx rexb + 0f 57 +- V W ++ V H W ++ sse2 avx + + + +@@ -8225,6 +8608,31 @@ + + + ++ xrstor ++ ++ aso rexw rexr rexx rexb ++ 0f ae /reg=5 /mod=!11 ++ M ++ ++ ++ ++ ++ xsave ++ ++ aso rexw rexr rexx rexb ++ 0f ae /reg=4 /mod=!11 ++ M ++ ++ ++ ++ ++ xsetbv ++ ++ 0f 01 /mod=11 /reg=2 /rm=1 ++ ++ ++ ++ + xsha1 + + 0f a6 /mod=11 /rm=0 /reg=1 +@@ -8246,7 +8654,25 @@ + + + +- db ++ pclmulqdq ++ ++ aso rexr rexx rexb ++ /sse=66 0f 3a 44 ++ V H W Ib ++ aesni avx ++ ++ ++ ++ ++ ++ ++ getsec ++ smx ++ ++ 0f 37 ++ + + + +- + +- addsubpd ++ haddpd + +- aso rexr rexx rexb +- sse66 0f d0 +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 7c ++ V H W ++ sse3 avx + + + + +- addsubps ++ haddps + +- aso rexr rexx rexb +- ssef2 0f d0 +- V W ++ aso rexr rexx rexb vexl ++ /sse=f2 0f 7c ++ V H W ++ sse3 avx + + + + +- haddpd ++ hsubpd + +- aso rexr rexx rexb +- sse66 0f 7c +- V W ++ aso rexr rexx rexb vexl ++ /sse=66 0f 7d ++ V H W ++ sse3 avx + + + + +- haddps ++ hsubps + +- aso rexr rexx rexb +- ssef2 0f 7c +- V W ++ aso rexr rexx rexb vexl ++ /sse=f2 0f 7d ++ V H W ++ sse3 avx + + + + +- hsubpd ++ insertps + +- aso rexr rexx rexb +- sse66 0f 7d +- V W ++ aso rexr rexw rexx rexb ++ /sse=66 0f 3a 21 ++ V H Md Ib ++ sse4.1 avx + + + + +- hsubps ++ lddqu + +- aso rexr rexx rexb +- ssef2 0f 7d +- V W ++ aso rexr rexx rexb vexl ++ /sse=f2 0f f0 ++ V M ++ sse3 avx + + + +@@ -8466,41 +8915,46 @@ + movddup + + aso rexr rexx rexb +- ssef2 0f 12 /mod=11 ++ /sse=f2 0f 12 /mod=11 + V W + + + aso rexr rexx rexb +- ssef2 0f 12 /mod=!11 ++ /sse=f2 0f 12 /mod=!11 + V W + ++ sse3 avx + + + + movshdup + +- aso rexr rexx rexb +- ssef3 0f 16 /mod=11 ++ aso rexr rexx rexb vexl ++ /sse=f3 0f 16 /mod=11 + V W ++ sse3 avx + + +- aso rexr rexx rexb +- ssef3 0f 16 /mod=!11 ++ aso rexr rexx rexb vexl ++ /sse=f3 0f 16 /mod=!11 + V W ++ sse3 avx + + + + + movsldup + +- aso rexr rexx rexb +- ssef3 0f 12 /mod=11 ++ aso rexr rexx rexb vexl ++ /sse=f3 0f 12 /mod=11 + V W ++ sse3 avx + + +- aso rexr rexx rexb +- ssef3 0f 12 /mod=!11 ++ aso rexr rexx rexb vexl ++ /sse=f3 0f 12 /mod=!11 + V W ++ sse3 avx + + + +@@ -8514,11 +8968,13 @@ + aso rexr rexx rexb + 0f 38 1c + P Q ++ ssse3 + + +- aso rexr rexx rexb +- sse66 0f 38 1c ++ aso rexr rexx rexb vexl ++ /sse=66 0f 38 1c + V W ++ ssse3 avx + + + +@@ -8528,11 +8984,13 @@ + aso rexr rexx rexb + 0f 38 1d + P Q ++ ssse3 + + +- aso rexr rexx rexb +- sse66 0f 38 1d ++ aso rexr rexx rexb vexl ++ /sse=66 0f 38 1d + V W ++ ssse3 avx + + + +@@ -8542,16 +9000,18 @@ + aso rexr rexx rexb + 0f 38 1e + P Q ++ ssse3 + + +- aso rexr rexx rexb +- sse66 0f 38 1e ++ aso rexr rexx rexb vexl ++ /sse=66 0f 38 1e + V W ++ ssse3 avx + + + + +- psignb ++ pshufb + + aso rexr rexx rexb + 0f 38 00 +@@ -8559,8 +9019,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 00 +- V W ++ /sse=66 0f 38 00 ++ V H W ++ ssse3 avx + + + +@@ -8573,8 +9034,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 01 +- V W ++ /sse=66 0f 38 01 ++ V H W ++ ssse3 avx + + + +@@ -8587,8 +9049,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 02 +- V W ++ /sse=66 0f 38 02 ++ V H W ++ ssse3 avx + + + +@@ -8601,8 +9064,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 03 +- V W ++ /sse=66 0f 38 03 ++ V H W ++ ssse3 avx + + + +@@ -8615,8 +9079,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 04 +- V W ++ /sse=66 0f 38 04 ++ V H W ++ ssse3 avx + + + +@@ -8629,8 +9094,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 05 +- V W ++ /sse=66 0f 38 05 ++ V H W ++ ssse3 avx + + + +@@ -8643,8 +9109,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 06 +- V W ++ /sse=66 0f 38 06 ++ V H W ++ ssse3 avx + + + +@@ -8657,8 +9124,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 07 +- V W ++ /sse=66 0f 38 07 ++ V H W ++ ssse3 avx + + + +@@ -8671,8 +9139,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 08 +- V W ++ /sse=66 0f 38 08 ++ V H W ++ ssse3 avx + + + +@@ -8685,8 +9154,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 0a +- V W ++ /sse=66 0f 38 0a ++ V H W ++ ssse3 avx + + + +@@ -8699,8 +9169,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 09 +- V W ++ /sse=66 0f 38 09 ++ V H W ++ ssse3 avx + + + +@@ -8713,8 +9184,9 @@ + + + aso rexr rexx rexb +- sse66 0f 38 0b +- V W ++ /sse=66 0f 38 0b ++ V H W ++ ssse3 avx + + + +@@ -8727,8 +9199,9 @@ + + + aso rexr rexx rexb +- sse66 0f 3a 0f +- V W Ib ++ /sse=66 0f 3a 0f ++ V H W Ib ++ ssse3 avx + + + +@@ -8740,8 +9213,9 @@ + pblendvb + + aso rexr rexx rexb +- sse66 0f 38 10 ++ /sse=66 0f 38 10 + V W ++ sse4.1 + + + +@@ -8749,8 +9223,9 @@ + pmuldq + + aso rexr rexx rexb +- sse66 0f 38 28 +- V W ++ /sse=66 0f 38 28 ++ V H W ++ sse4.1 avx + + + +@@ -8758,8 +9233,9 @@ + pminsb + + aso rexr rexx rexb +- sse66 0f 38 38 +- V W ++ /sse=66 0f 38 38 ++ V H W ++ sse4.1 avx + + + +@@ -8767,8 +9243,9 @@ + pminsd + + aso rexr rexx rexb +- sse66 0f 38 39 +- V W ++ /sse=66 0f 38 39 ++ V H W ++ sse4.1 avx + + + +@@ -8776,8 +9253,9 @@ + pminuw + + aso rexr rexx rexb +- sse66 0f 38 3a +- V W ++ /sse=66 0f 38 3a ++ V H W ++ sse4.1 avx + + + +@@ -8785,8 +9263,9 @@ + pminud + + aso rexr rexx rexb +- sse66 0f 38 3b +- V W ++ /sse=66 0f 38 3b ++ V H W ++ sse4.1 avx + + + +@@ -8794,8 +9273,9 @@ + pmaxsb + + aso rexr rexx rexb +- sse66 0f 38 3c +- V W ++ /sse=66 0f 38 3c ++ V H W ++ sse4.1 avx + + + +@@ -8803,8 +9283,9 @@ + pmaxsd + + aso rexr rexx rexb +- sse66 0f 38 3d +- V W ++ /sse=66 0f 38 3d ++ V H W ++ sse4.1 avx + + + +@@ -8812,8 +9293,19 @@ + pmaxud + + aso rexr rexx rexb +- sse66 0f 38 3f +- V W ++ /sse=66 0f 38 3f ++ V H W ++ sse4.1 avx ++ ++ ++ ++ ++ pmaxuw ++ ++ aso rexr rexx rexb ++ /sse=66 0f 38 3e ++ V H W ++ sse4.1 avx + + + +@@ -8821,8 +9313,9 @@ + pmulld + + aso rexr rexx rexb +- sse66 0f 38 40 +- V W ++ /sse=66 0f 38 40 ++ V H W ++ sse4.1 avx + + + +@@ -8830,26 +9323,29 @@ + phminposuw + + aso rexr rexx rexb +- sse66 0f 38 41 ++ /sse=66 0f 38 41 + V W ++ sse4.1 avx + + + + + roundps + +- aso rexr rexx rexb +- sse66 0f 3a 08 ++ aso rexr rexx rexb vexl ++ /sse=66 0f 3a 08 + V W Ib ++ sse avx + + + + + roundpd + +- aso rexr rexx rexb +- sse66 0f 3a 09 ++ aso rexr rexx rexb vexl ++ /sse=66 0f 3a 09 + V W Ib ++ sse4.1 avx + + + +@@ -8857,8 +9353,9 @@ + roundss + + aso rexr rexx rexb +- sse66 0f 3a 0a +- V W Ib ++ /sse=66 0f 3a 0a ++ V H W Ib ++ sse4.1 avx + + + +@@ -8866,89 +9363,448 @@ + roundsd + + aso rexr rexx rexb +- sse66 0f 3a 0b +- V W Ib ++ /sse=66 0f 3a 0b ++ V H W Ib ++ sse4.1 avx + + + + + blendpd + +- aso rexr rexx rexb +- sse66 0f 3a 0d +- V W Ib ++ aso rexr rexx rexb vexl ++ /sse=66 0f 3a 0d ++ V H W Ib ++ sse4.1 avx + + + + +- pblendw ++ blendps + + aso rexr rexx rexb +- sse66 0f 3a 0e +- V W Ib ++ /sse=66 0f 3a 0c ++ V H W Ib ++ sse4.1 avx + + + + +- blendps ++ blendvpd + + aso rexr rexx rexb +- sse66 0f 3a 0c +- V W Ib ++ /sse=66 0f 38 15 ++ V W ++ sse4.1 + + + + +- blendvpd ++ blendvps + + aso rexr rexx rexb +- sse66 0f 38 15 ++ /sse=66 0f 38 14 + V W ++ sse4.1 + + + + +- blendvps ++ bound ++ ++ aso oso ++ 62 /m=!64 ++ Gv M ++ ++ ++ ++ ++ bsf ++ ++ aso oso rexw rexr rexx rexb ++ 0f bc ++ Gv Ev ++ ++ ++ ++ ++ bsr ++ ++ aso oso rexw rexr rexx rexb ++ 0f bd ++ Gv Ev ++ ++ ++ ++ ++ bswap ++ ++ oso rexw rexb ++ 0f c8 ++ R0y ++ ++ ++ oso rexw rexb ++ 0f c9 ++ R1y ++ ++ ++ oso rexw rexb ++ 0f ca ++ R2y ++ ++ ++ oso rexw rexb ++ 0f cb ++ R3y ++ ++ ++ oso rexw rexb ++ 0f cc ++ R4y ++ ++ ++ oso rexw rexb ++ 0f cd ++ R5y ++ ++ ++ oso rexw rexb ++ 0f ce ++ R6y ++ ++ ++ oso rexw rexb ++ 0f cf ++ R7y ++ ++ ++ ++ ++ bt ++ ++ aso oso rexw rexr rexx rexb ++ 0f ba /reg=4 ++ Ev Ib ++ ++ ++ aso oso rexw rexr rexx rexb ++ 0f a3 ++ Ev Gv ++ ++ ++ ++ ++ btc ++ ++ aso oso rexw rexr rexx rexb ++ 0f bb ++ Ev Gv ++ ++ ++ aso oso rexw rexr rexx rexb ++ 0f ba /reg=7 ++ Ev Ib ++ ++ ++ ++ ++ btr ++ ++ aso oso rexw rexr rexx rexb ++ 0f b3 ++ Ev Gv ++ ++ ++ aso oso rexw rexr rexx rexb ++ 0f ba /reg=6 ++ Ev Ib ++ ++ ++ ++ ++ bts ++ ++ aso oso rexw rexr rexx rexb ++ 0f ab ++ Ev Gv ++ ++ ++ aso oso rexw rexr rexx rexb ++ 0f ba /reg=5 ++ Ev Ib ++ ++ ++ ++ ++ pblendw + + aso rexr rexx rexb +- sse66 0f 38 14 ++ /sse=66 0f 3a 0e ++ V H W Ib ++ sse4.1 avx ++ ++ ++ ++ ++ mpsadbw ++ ++ aso rexr rexx rexb vexl ++ /sse=66 0f 3a 42 ++ V H W Ib ++ sse4.1 avx ++ ++ ++ ++ ++ movntdqa ++ ++ aso rexr rexw rexx rexb vexl ++ /sse=66 0f 38 2a ++ V M ++ sse4.1 avx ++ ++ ++ ++ ++ packusdw ++ ++ aso rexr rexw rexx rexb vexl ++ /sse=66 0f 38 2b ++ V H W ++ sse2 avx ++ ++ ++ ++ ++ pmovsxbw ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 20 ++ V MqU ++ sse4.1 avx ++ ++ ++ ++ ++ pmovsxbd ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 21 ++ V MdU ++ sse4.1 avx ++ ++ ++ ++ ++ pmovsxbq ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 22 ++ V MwU ++ sse4.1 avx ++ ++ ++ ++ ++ pmovsxwd ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 23 ++ V MqU ++ sse4.1 avx ++ ++ ++ ++ ++ pmovsxwq ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 24 ++ V MdU ++ sse4.1 avx ++ ++ ++ ++ ++ pmovsxdq ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 25 ++ V MqU ++ sse4.1 ++ ++ ++ ++ ++ pmovzxbw ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 30 ++ V MqU ++ sse4.1 avx ++ ++ ++ ++ ++ pmovzxbd ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 31 ++ V MdU ++ sse4.1 avx ++ ++ ++ ++ ++ pmovzxbq ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 32 ++ V MwU ++ sse4.1 avx ++ ++ ++ ++ ++ pmovzxwd ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 33 ++ V MqU ++ sse4.1 avx ++ ++ ++ ++ ++ pmovzxwq ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 34 ++ V MdU ++ sse4.1 avx ++ ++ ++ ++ ++ pmovzxdq ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 35 ++ V MqU ++ sse4.1 avx ++ ++ ++ ++ ++ pcmpeqq ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 29 ++ V H W ++ sse4.1 avx ++ ++ ++ ++ ++ popcnt ++ ++ aso oso rexr rexw rexx rexb ++ /sse=f3 0f b8 ++ Gv Ev ++ ++ sse4.2 ++ ++ ++ ++ ptest ++ ++ aso rexr rexw rexx rexb vexl ++ /sse=66 0f 38 17 + V W ++ sse4.1 avx + + + + +- dpps ++ pcmpestri + +- aso rexr rexx rexb +- sse66 0f 3a 40 ++ aso rexr rexw rexx rexb ++ /sse=66 0f 3a 61 + V W Ib ++ sse4.2 avx + + + + +- dppd ++ pcmpestrm + +- aso rexr rexx rexb +- sse66 0f 3a 41 ++ aso rexr rexw rexx rexb ++ /sse=66 0f 3a 60 + V W Ib ++ sse4.2 avx + + + + +- mpsadbw ++ pcmpgtq + +- aso rexr rexx rexb +- sse66 0f 3a 42 ++ aso rexr rexw rexx rexb ++ /sse=66 0f 38 37 ++ V H W ++ sse4.2 avx ++ ++ ++ ++ ++ pcmpistri ++ ++ aso rexr rexw rexx rexb ++ /sse=66 0f 3a 63 + V W Ib ++ sse4.2 avx + + + + +- extractps ++ pcmpistrm + +- aso rexr rexw rexb +- sse66 0f 3a 17 +- MdRy V Ib ++ aso rexr rexw rexx rexb ++ /sse=66 0f 3a 62 ++ V W Ib ++ sse4.2 avx ++ ++ ++ ++ ++ movbe ++ ++ aso oso rexr rexw rexx rexb ++ 0f 38 f0 ++ Gv Mv ++ sse3 atom ++ ++ ++ aso oso rexr rexw rexx rexb ++ 0f 38 f1 ++ Mv Gv ++ sse3 atom ++ ++ ++ ++ ++ crc32 ++ ++ aso oso rexr rexw rexx rexb ++ /sse=f2 0f 38 f0 ++ Gy Eb ++ sse4.2 ++ ++ ++ aso oso rexr rexw rexx rexb ++ /sse=f2 0f 38 f1 ++ Gy Ev ++ sse4.2 + + + +@@ -8956,4 +9812,288 @@ + invalid + + ++ ++ vbroadcastss ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f38 18 /vexw=0 ++ V Md ++ avx ++ ++ ++ ++ ++ vbroadcastsd ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f38 19 /vexw=0 /vexl=1 ++ Vqq Mq ++ avx ++ ++ ++ ++ ++ vextractf128 ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f3a 19 /vexw=0 /vexl=1 ++ Wdq Vqq Ib ++ avx ++ ++ ++ ++ ++ vinsertf128 ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f3a 18 /vexw=0 /vexl=1 ++ Vqq Hqq Wdq Ib ++ avx ++ ++ ++ ++ ++ vmaskmovps ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f38 2c /vexw=0 ++ V H M ++ avx ++ ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f38 2e /vexw=0 ++ M H V ++ avx ++ ++ ++ ++ ++ vmaskmovpd ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f38 2d /vexw=0 ++ V H M ++ avx ++ ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f38 2f /vexw=0 ++ M H V ++ avx ++ ++ ++ ++ ++ vpermilpd ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f38 0d /vexw=0 ++ Vx Hx Wx ++ avx ++ ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f3a 05 /vexw=0 ++ V W Ib ++ avx ++ ++ ++ ++ ++ vpermilps ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f38 0c /vexw=0 ++ Vx Hx Wx ++ avx ++ ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f3a 04 /vexw=0 ++ Vx Wx Ib ++ avx ++ ++ ++ ++ ++ vperm2f128 ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f3a 06 /vexw=0 /vexl=1 ++ Vqq Hqq Wqq Ib ++ avx ++ ++ ++ ++ ++ vtestps ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f38 0e /vexw=0 ++ Vx Wx ++ avx ++ ++ ++ ++ ++ vtestpd ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f38 0f /vexw=0 ++ Vx Wx ++ avx ++ ++ ++ ++ ++ vzeroupper ++ ++ /vex=0f 77 /vexl=0 ++ avx ++ ++ ++ ++ ++ vzeroall ++ ++ /vex=0f 77 /vexl=1 ++ avx ++ ++ ++ ++ ++ vblendvpd ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f3a 4b /vexw=0 ++ Vx Hx Wx Lx ++ avx ++ ++ ++ ++ ++ vblendvps ++ ++ aso rexr rexx rexb vexl ++ /vex=66_0f3a 4a /vexw=0 ++ Vx Hx Wx Lx ++ avx ++ ++ ++ ++ ++ vmovsd ++ ++ aso rexr rexx rexb ++ /vex=f2_0f 10 /mod=11 ++ V H U ++ avx ++ ++ ++ aso rexr rexx rexb ++ /vex=f2_0f 10 /mod=!11 ++ V Mq ++ avx ++ ++ ++ aso rexr rexx rexb ++ /vex=f2_0f 11 /mod=11 ++ U H V ++ avx ++ ++ ++ aso rexr rexx rexb ++ /vex=f2_0f 11 /mod=!11 ++ Mq V ++ avx ++ ++ ++ ++ ++ vmovss ++ ++ aso rexr rexx rexb ++ /vex=f3_0f 10 /mod=11 ++ V H U ++ avx ++ ++ ++ aso rexr rexx rexb ++ /vex=f3_0f 10 /mod=!11 ++ V Md ++ avx ++ ++ ++ aso rexr rexx rexb ++ /vex=f3_0f 11 /mod=11 ++ U H V ++ avx ++ ++ ++ aso rexr rexx rexb ++ /vex=f3_0f 11 /mod=!11 ++ Md V ++ avx ++ ++ ++ ++ ++ vpblendvb ++ ++ aso rexr rexx rexb ++ /vex=66_0f3a 4c /vexw=0 ++ V H W L ++ avx ++ ++ ++ ++ ++ vpsllw ++ ++ aso rexr rexx rexb ++ /vex=66_0f f1 /vexl=0 ++ V H W ++ avx ++ ++ ++ aso rexr rexx rexb ++ /vex=66_0f 71 /reg=6 /vexl=0 ++ H V W ++ avx ++ ++ ++ ++ ++ vpslld ++ ++ aso rexr rexx rexb ++ /vex=66_0f f2 /vexl=0 ++ V H W ++ avx ++ ++ ++ aso rexr rexx rexb ++ /vex=66_0f 72 /reg=6 /vexl=0 ++ H V W ++ avx ++ ++ ++ ++ ++ vpsllq ++ ++ aso rexr rexx rexb ++ /vex=66_0f f3 /vexl=0 ++ V H W ++ avx ++ ++ ++ aso rexr rexx rexb ++ /vex=66_0f 73 /reg=6 /vexl=0 ++ H V W ++ avx ++ ++ ++ + +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86.c b/Source/JavaScriptCore/disassembler/udis86/udis86.c +--- a/Source/JavaScriptCore/disassembler/udis86/udis86.c 2016-05-21 18:54:11.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86.c 2019-06-10 00:48:46.000000000 +0300 +@@ -1,6 +1,6 @@ + /* udis86 - libudis86/udis86.c + * +- * Copyright (c) 2002-2009 Vivek Thampi ++ * Copyright (c) 2002-2013 Vivek Thampi + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without modification, +@@ -28,16 +28,19 @@ + + #if USE(UDIS86) + +-#include "udis86_input.h" ++#include "udis86_udint.h" + #include "udis86_extern.h" ++#include "udis86_decode.h" + +-#ifndef __UD_STANDALONE__ +-# include +-# include +-#endif /* __UD_STANDALONE__ */ ++#if !defined(__UD_STANDALONE__) ++#include ++#endif /* !__UD_STANDALONE__ */ ++ ++static void ud_inp_init(struct ud *u); + + /* ============================================================================= +- * ud_init() - Initializes ud_t object. ++ * ud_init ++ * Initializes ud_t object. + * ============================================================================= + */ + extern void +@@ -50,30 +53,34 @@ + #ifndef __UD_STANDALONE__ + ud_set_input_file(u, stdin); + #endif /* __UD_STANDALONE__ */ ++ ++ ud_set_asm_buffer(u, u->asm_buf_int, sizeof(u->asm_buf_int)); + } + ++ + /* ============================================================================= +- * ud_disassemble() - disassembles one instruction and returns the number of +- * bytes disassembled. A zero means end of disassembly. ++ * ud_disassemble ++ * Disassembles one instruction and returns the number of ++ * bytes disassembled. A zero means end of disassembly. + * ============================================================================= + */ + extern unsigned int + ud_disassemble(struct ud* u) + { +- if (ud_input_end(u)) +- return 0; +- +- +- u->insn_buffer[0] = u->insn_hexcode[0] = 0; +- +- +- if (ud_decode(u) == 0) +- return 0; +- if (u->translator) +- u->translator(u); +- return ud_insn_len(u); ++ int len; ++ if (u->inp_end) { ++ return 0; ++ } ++ if ((len = ud_decode(u)) > 0) { ++ if (u->translator != NULL) { ++ u->asm_buf[0] = '\0'; ++ u->translator(u); ++ } ++ } ++ return len; + } + ++ + /* ============================================================================= + * ud_set_mode() - Set Disassemly Mode. + * ============================================================================= +@@ -82,10 +89,10 @@ + ud_set_mode(struct ud* u, uint8_t m) + { + switch(m) { +- case 16: +- case 32: +- case 64: u->dis_mode = m ; return; +- default: u->dis_mode = 16; return; ++ case 16: ++ case 32: ++ case 64: u->dis_mode = m ; return; ++ default: u->dis_mode = 16; return; + } + } + +@@ -97,14 +104,14 @@ + ud_set_vendor(struct ud* u, unsigned v) + { + switch(v) { +- case UD_VENDOR_INTEL: +- u->vendor = v; +- break; +- case UD_VENDOR_ANY: +- u->vendor = v; +- break; +- default: +- u->vendor = UD_VENDOR_AMD; ++ case UD_VENDOR_INTEL: ++ u->vendor = v; ++ break; ++ case UD_VENDOR_ANY: ++ u->vendor = v; ++ break; ++ default: ++ u->vendor = UD_VENDOR_AMD; + } + } + +@@ -132,18 +139,18 @@ + * ud_insn() - returns the disassembled instruction + * ============================================================================= + */ +-extern char* +-ud_insn_asm(struct ud* u) ++const char* ++ud_insn_asm(const struct ud* u) + { +- return u->insn_buffer; ++ return u->asm_buf; + } + + /* ============================================================================= + * ud_insn_offset() - Returns the offset. + * ============================================================================= + */ +-extern uint64_t +-ud_insn_off(struct ud* u) ++uint64_t ++ud_insn_off(const struct ud* u) + { + return u->insn_offset; + } +@@ -153,30 +160,303 @@ + * ud_insn_hex() - Returns hex form of disassembled instruction. + * ============================================================================= + */ +-extern char* ++const char* + ud_insn_hex(struct ud* u) + { ++ u->insn_hexcode[0] = 0; ++ if (!u->error) { ++ unsigned int i; ++ const unsigned char *src_ptr = ud_insn_ptr(u); ++ char* src_hex = (char*) u->insn_hexcode; ++ char* const src_hex_base = src_hex; ++ /* for each byte used to decode instruction */ ++ for (i = 0; i < ud_insn_len(u) && i < sizeof(u->insn_hexcode) / 2; ++ ++i, ++src_ptr) { ++ snprintf(src_hex, sizeof(u->insn_hexcode) - (src_hex - src_hex_base), "%02x", *src_ptr & 0xFF); ++ src_hex += 2; ++ } ++ } + return u->insn_hexcode; + } + ++ + /* ============================================================================= +- * ud_insn_ptr() - Returns code disassembled. ++ * ud_insn_ptr ++ * Returns a pointer to buffer containing the bytes that were ++ * disassembled. + * ============================================================================= + */ +-extern uint8_t* +-ud_insn_ptr(struct ud* u) ++extern const uint8_t* ++ud_insn_ptr(const struct ud* u) + { +- return u->inp_sess; ++ return (u->inp_buf == NULL) ? ++ u->inp_sess : u->inp_buf + (u->inp_buf_index - u->inp_ctr); + } + ++ + /* ============================================================================= +- * ud_insn_len() - Returns the count of bytes disassembled. ++ * ud_insn_len ++ * Returns the count of bytes disassembled. + * ============================================================================= + */ + extern unsigned int +-ud_insn_len(struct ud* u) ++ud_insn_len(const struct ud* u) + { + return u->inp_ctr; + } + ++ ++/* ============================================================================= ++ * ud_insn_get_opr ++ * Return the operand struct representing the nth operand of ++ * the currently disassembled instruction. Returns NULL if ++ * there's no such operand. ++ * ============================================================================= ++ */ ++const struct ud_operand* ++ud_insn_opr(const struct ud *u, unsigned int n) ++{ ++ if (n > 3 || u->operand[n].type == UD_NONE) { ++ return NULL; ++ } else { ++ return &u->operand[n]; ++ } ++} ++ ++ ++/* ============================================================================= ++ * ud_opr_is_sreg ++ * Returns non-zero if the given operand is of a segment register type. ++ * ============================================================================= ++ */ ++int ++ud_opr_is_sreg(const struct ud_operand *opr) ++{ ++ return opr->type == UD_OP_REG && ++ opr->base >= UD_R_ES && ++ opr->base <= UD_R_GS; ++} ++ ++ ++/* ============================================================================= ++ * ud_opr_is_sreg ++ * Returns non-zero if the given operand is of a general purpose ++ * register type. ++ * ============================================================================= ++ */ ++int ++ud_opr_is_gpr(const struct ud_operand *opr) ++{ ++ return opr->type == UD_OP_REG && ++ opr->base >= UD_R_AL && ++ opr->base <= UD_R_R15; ++} ++ ++ ++/* ============================================================================= ++ * ud_set_user_opaque_data ++ * ud_get_user_opaque_data ++ * Get/set user opaqute data pointer ++ * ============================================================================= ++ */ ++void ++ud_set_user_opaque_data(struct ud * u, void* opaque) ++{ ++ u->user_opaque_data = opaque; ++} ++ ++void* ++ud_get_user_opaque_data(const struct ud *u) ++{ ++ return u->user_opaque_data; ++} ++ ++ ++/* ============================================================================= ++ * ud_set_asm_buffer ++ * Allow the user to set an assembler output buffer. If `buf` is NULL, ++ * we switch back to the internal buffer. ++ * ============================================================================= ++ */ ++void ++ud_set_asm_buffer(struct ud *u, char *buf, size_t size) ++{ ++ if (buf == NULL) { ++ ud_set_asm_buffer(u, u->asm_buf_int, sizeof(u->asm_buf_int)); ++ } else { ++ u->asm_buf = buf; ++ u->asm_buf_size = size; ++ } ++} ++ ++ ++/* ============================================================================= ++ * ud_set_sym_resolver ++ * Set symbol resolver for relative targets used in the translation ++ * phase. ++ * ++ * The resolver is a function that takes a uint64_t address and returns a ++ * symbolic name for the that address. The function also takes a second ++ * argument pointing to an integer that the client can optionally set to a ++ * non-zero value for offsetted targets. (symbol+offset) The function may ++ * also return NULL, in which case the translator only prints the target ++ * address. ++ * ++ * The function pointer maybe NULL which resets symbol resolution. ++ * ============================================================================= ++ */ ++void ++ud_set_sym_resolver(struct ud *u, const char* (*resolver)(struct ud*, ++ uint64_t addr, ++ int64_t *offset)) ++{ ++ u->sym_resolver = resolver; ++} ++ ++ ++/* ============================================================================= ++ * ud_insn_mnemonic ++ * Return the current instruction mnemonic. ++ * ============================================================================= ++ */ ++enum ud_mnemonic_code ++ud_insn_mnemonic(const struct ud *u) ++{ ++ return u->mnemonic; ++} ++ ++ ++/* ============================================================================= ++ * ud_lookup_mnemonic ++ * Looks up mnemonic code in the mnemonic string table. ++ * Returns NULL if the mnemonic code is invalid. ++ * ============================================================================= ++ */ ++const char* ++ud_lookup_mnemonic(enum ud_mnemonic_code c) ++{ ++ if (c < UD_MAX_MNEMONIC_CODE) { ++ return ud_mnemonics_str[c]; ++ } else { ++ return NULL; ++ } ++} ++ ++ ++/* ++ * ud_inp_init ++ * Initializes the input system. ++ */ ++static void ++ud_inp_init(struct ud *u) ++{ ++ u->inp_hook = NULL; ++ u->inp_buf = NULL; ++ u->inp_buf_size = 0; ++ u->inp_buf_index = 0; ++ u->inp_curr = 0; ++ u->inp_ctr = 0; ++ u->inp_end = 0; ++ u->inp_peek = UD_EOI; ++ UD_NON_STANDALONE(u->inp_file = NULL); ++} ++ ++ ++/* ============================================================================= ++ * ud_inp_set_hook ++ * Sets input hook. ++ * ============================================================================= ++ */ ++void ++ud_set_input_hook(register struct ud* u, int (*hook)(struct ud*)) ++{ ++ ud_inp_init(u); ++ u->inp_hook = hook; ++} ++ ++/* ============================================================================= ++ * ud_inp_set_buffer ++ * Set buffer as input. ++ * ============================================================================= ++ */ ++void ++ud_set_input_buffer(register struct ud* u, const uint8_t* buf, size_t len) ++{ ++ ud_inp_init(u); ++ u->inp_buf = buf; ++ u->inp_buf_size = len; ++ u->inp_buf_index = 0; ++} ++ ++ ++#ifndef __UD_STANDALONE__ ++/* ============================================================================= ++ * ud_input_set_file ++ * Set FILE as input. ++ * ============================================================================= ++ */ ++static int ++inp_file_hook(struct ud* u) ++{ ++ return fgetc(u->inp_file); ++} ++ ++void ++ud_set_input_file(register struct ud* u, FILE* f) ++{ ++ ud_inp_init(u); ++ u->inp_hook = inp_file_hook; ++ u->inp_file = f; ++} ++#endif /* __UD_STANDALONE__ */ ++ ++ ++/* ============================================================================= ++ * ud_input_skip ++ * Skip n input bytes. ++ * ============================================================================ ++ */ ++void ++ud_input_skip(struct ud* u, size_t n) ++{ ++ if (u->inp_end) { ++ return; ++ } ++ if (u->inp_buf == NULL) { ++ while (n--) { ++ int c = u->inp_hook(u); ++ if (c == UD_EOI) { ++ goto eoi; ++ } ++ } ++ return; ++ } else { ++ if (n > u->inp_buf_size || ++ u->inp_buf_index > u->inp_buf_size - n) { ++ u->inp_buf_index = u->inp_buf_size; ++ goto eoi; ++ } ++ u->inp_buf_index += n; ++ return; ++ } ++eoi: ++ u->inp_end = 1; ++ UDERR(u, "cannot skip, eoi received\b"); ++ return; ++} ++ ++ ++/* ============================================================================= ++ * ud_input_end ++ * Returns non-zero on end-of-input. ++ * ============================================================================= ++ */ ++int ++ud_input_end(const struct ud *u) ++{ ++ return u->inp_end; ++} ++ + #endif // USE(UDIS86) ++ ++/* vim:set ts=2 sw=2 expandtab */ +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_decode.c b/Source/JavaScriptCore/disassembler/udis86/udis86_decode.c +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_decode.c 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_decode.c 2019-06-10 00:48:46.000000000 +0300 +@@ -28,14 +28,10 @@ + + #if USE(UDIS86) + +-#include "udis86_extern.h" ++#include "udis86_udint.h" + #include "udis86_types.h" +-#include "udis86_input.h" ++#include "udis86_extern.h" + #include "udis86_decode.h" +-#include +- +-#define dbg(x, n...) +-/* #define dbg printf */ + + #ifndef __UD_STANDALONE__ + # include +@@ -44,15 +40,164 @@ + /* The max number of prefixes to an instruction */ + #define MAX_PREFIXES 15 + +-/* instruction aliases and special cases */ +-static struct ud_itab_entry s_ie__invalid = +- { UD_Iinvalid, O_NONE, O_NONE, O_NONE, P_none }; ++/* rex prefix bits */ ++#define REX_W(r) ( ( 0xF & ( r ) ) >> 3 ) ++#define REX_R(r) ( ( 0x7 & ( r ) ) >> 2 ) ++#define REX_X(r) ( ( 0x3 & ( r ) ) >> 1 ) ++#define REX_B(r) ( ( 0x1 & ( r ) ) >> 0 ) ++#define REX_PFX_MASK(n) ( ( P_REXW(n) << 3 ) | \ ++ ( P_REXR(n) << 2 ) | \ ++ ( P_REXX(n) << 1 ) | \ ++ ( P_REXB(n) << 0 ) ) ++ ++/* scable-index-base bits */ ++#define SIB_S(b) ( ( b ) >> 6 ) ++#define SIB_I(b) ( ( ( b ) >> 3 ) & 7 ) ++#define SIB_B(b) ( ( b ) & 7 ) ++ ++/* modrm bits */ ++#define MODRM_REG(b) ( ( ( b ) >> 3 ) & 7 ) ++#define MODRM_NNN(b) ( ( ( b ) >> 3 ) & 7 ) ++#define MODRM_MOD(b) ( ( ( b ) >> 6 ) & 3 ) ++#define MODRM_RM(b) ( ( b ) & 7 ) ++ ++static int decode_ext(struct ud *u, uint16_t ptr); ++static int decode_opcode(struct ud *u); ++ ++enum reg_class { /* register classes */ ++ REGCLASS_GPR, ++ REGCLASS_MMX, ++ REGCLASS_CR, ++ REGCLASS_DB, ++ REGCLASS_SEG, ++ REGCLASS_XMM ++}; ++ ++ /* ++ * inp_start ++ * Should be called before each de-code operation. ++ */ ++static void ++inp_start(struct ud *u) ++{ ++ u->inp_ctr = 0; ++} + +-static int +-decode_ext(struct ud *u, uint16_t ptr); ++static uint8_t ++inp_peek(struct ud *u) ++{ ++ if (u->inp_end == 0) { ++ if (u->inp_buf != NULL) { ++ if (u->inp_buf_index < u->inp_buf_size) { ++ return u->inp_buf[u->inp_buf_index]; ++ } ++ } else if (u->inp_peek != UD_EOI) { ++ return u->inp_peek; ++ } else { ++ int c; ++ if ((c = u->inp_hook(u)) != UD_EOI) { ++ u->inp_peek = c; ++ return u->inp_peek; ++ } ++ } ++ } ++ u->inp_end = 1; ++ UDERR(u, "byte expected, eoi received\n"); ++ return 0; ++} ++ ++static uint8_t ++inp_next(struct ud *u) ++{ ++ if (u->inp_end == 0) { ++ if (u->inp_buf != NULL) { ++ if (u->inp_buf_index < u->inp_buf_size) { ++ u->inp_ctr++; ++ return (u->inp_curr = u->inp_buf[u->inp_buf_index++]); ++ } ++ } else { ++ int c = u->inp_peek; ++ if (c != UD_EOI || (c = u->inp_hook(u)) != UD_EOI) { ++ u->inp_peek = UD_EOI; ++ u->inp_curr = c; ++ u->inp_sess[u->inp_ctr++] = u->inp_curr; ++ return u->inp_curr; ++ } ++ } ++ } ++ u->inp_end = 1; ++ UDERR(u, "byte expected, eoi received\n"); ++ return 0; ++} ++ ++static uint8_t ++inp_curr(struct ud *u) ++{ ++ return u->inp_curr; ++} ++ ++ ++/* ++ * inp_uint8 ++ * int_uint16 ++ * int_uint32 ++ * int_uint64 ++ * Load little-endian values from input ++ */ ++static uint8_t ++inp_uint8(struct ud* u) ++{ ++ return inp_next(u); ++} ++ ++static uint16_t ++inp_uint16(struct ud* u) ++{ ++ uint16_t r, ret; + ++ ret = inp_next(u); ++ r = inp_next(u); ++ return ret | (r << 8); ++} + +-static inline int ++static uint32_t ++inp_uint32(struct ud* u) ++{ ++ uint32_t r, ret; ++ ++ ret = inp_next(u); ++ r = inp_next(u); ++ ret = ret | (r << 8); ++ r = inp_next(u); ++ ret = ret | (r << 16); ++ r = inp_next(u); ++ return ret | (r << 24); ++} ++ ++static uint64_t ++inp_uint64(struct ud* u) ++{ ++ uint64_t r, ret; ++ ++ ret = inp_next(u); ++ r = inp_next(u); ++ ret = ret | (r << 8); ++ r = inp_next(u); ++ ret = ret | (r << 16); ++ r = inp_next(u); ++ ret = ret | (r << 24); ++ r = inp_next(u); ++ ret = ret | (r << 32); ++ r = inp_next(u); ++ ret = ret | (r << 40); ++ r = inp_next(u); ++ ret = ret | (r << 48); ++ r = inp_next(u); ++ return ret | (r << 56); ++} ++ ++ ++static UD_INLINE int + eff_opr_mode(int dis_mode, int rex_w, int pfx_opr) + { + if (dis_mode == 64) { +@@ -60,13 +205,13 @@ + } else if (dis_mode == 32) { + return pfx_opr ? 16 : 32; + } else { +- ASSERT(dis_mode == 16); ++ UD_ASSERT(dis_mode == 16); + return pfx_opr ? 32 : 16; + } + } + + +-static inline int ++static UD_INLINE int + eff_adr_mode(int dis_mode, int pfx_adr) + { + if (dis_mode == 64) { +@@ -74,21 +219,12 @@ + } else if (dis_mode == 32) { + return pfx_adr ? 16 : 32; + } else { +- ASSERT(dis_mode == 16); ++ UD_ASSERT(dis_mode == 16); + return pfx_adr ? 32 : 16; + } + } + + +-/* Looks up mnemonic code in the mnemonic string table +- * Returns NULL if the mnemonic code is invalid +- */ +-const char * ud_lookup_mnemonic( enum ud_mnemonic_code c ) +-{ +- return ud_mnemonics_str[ c ]; +-} +- +- + /* + * decode_prefixes + * +@@ -97,164 +233,128 @@ + static int + decode_prefixes(struct ud *u) + { +- unsigned int have_pfx = 1; +- unsigned int i; +- uint8_t curr; +- +- /* if in error state, bail out */ +- if ( u->error ) +- return -1; +- +- /* keep going as long as there are prefixes available */ +- for ( i = 0; have_pfx ; ++i ) { +- +- /* Get next byte. */ +- ud_inp_next(u); +- if ( u->error ) +- return -1; +- curr = ud_inp_curr( u ); +- +- /* rex prefixes in 64bit mode */ +- if ( u->dis_mode == 64 && ( curr & 0xF0 ) == 0x40 ) { +- u->pfx_rex = curr; +- } else { +- switch ( curr ) +- { +- case 0x2E : +- u->pfx_seg = UD_R_CS; +- u->pfx_rex = 0; +- break; +- case 0x36 : +- u->pfx_seg = UD_R_SS; +- u->pfx_rex = 0; +- break; +- case 0x3E : +- u->pfx_seg = UD_R_DS; +- u->pfx_rex = 0; +- break; +- case 0x26 : +- u->pfx_seg = UD_R_ES; +- u->pfx_rex = 0; +- break; +- case 0x64 : +- u->pfx_seg = UD_R_FS; +- u->pfx_rex = 0; +- break; +- case 0x65 : +- u->pfx_seg = UD_R_GS; +- u->pfx_rex = 0; +- break; +- case 0x67 : /* adress-size override prefix */ +- u->pfx_adr = 0x67; +- u->pfx_rex = 0; +- break; +- case 0xF0 : +- u->pfx_lock = 0xF0; +- u->pfx_rex = 0; +- break; +- case 0x66: +- /* the 0x66 sse prefix is only effective if no other sse prefix +- * has already been specified. +- */ +- if ( !u->pfx_insn ) u->pfx_insn = 0x66; +- u->pfx_opr = 0x66; +- u->pfx_rex = 0; +- break; +- case 0xF2: +- u->pfx_insn = 0xF2; +- u->pfx_repne = 0xF2; +- u->pfx_rex = 0; +- break; +- case 0xF3: +- u->pfx_insn = 0xF3; +- u->pfx_rep = 0xF3; +- u->pfx_repe = 0xF3; +- u->pfx_rex = 0; +- break; +- default : +- /* No more prefixes */ +- have_pfx = 0; +- break; +- } +- } +- +- /* check if we reached max instruction length */ +- if ( i + 1 == MAX_INSN_LENGTH ) { +- u->error = 1; +- break; +- } ++ int done = 0; ++ uint8_t curr = 0, last = 0; ++ UD_RETURN_ON_ERROR(u); ++ ++ do { ++ last = curr; ++ curr = inp_next(u); ++ UD_RETURN_ON_ERROR(u); ++ if (u->inp_ctr == MAX_INSN_LENGTH) { ++ UD_RETURN_WITH_ERROR(u, "max instruction length"); + } ++ ++ switch (curr) ++ { ++ case 0x2E: ++ u->pfx_seg = UD_R_CS; ++ break; ++ case 0x36: ++ u->pfx_seg = UD_R_SS; ++ break; ++ case 0x3E: ++ u->pfx_seg = UD_R_DS; ++ break; ++ case 0x26: ++ u->pfx_seg = UD_R_ES; ++ break; ++ case 0x64: ++ u->pfx_seg = UD_R_FS; ++ break; ++ case 0x65: ++ u->pfx_seg = UD_R_GS; ++ break; ++ case 0x67: /* adress-size override prefix */ ++ u->pfx_adr = 0x67; ++ break; ++ case 0xF0: ++ u->pfx_lock = 0xF0; ++ break; ++ case 0x66: ++ u->pfx_opr = 0x66; ++ break; ++ case 0xF2: ++ u->pfx_str = 0xf2; ++ break; ++ case 0xF3: ++ u->pfx_str = 0xf3; ++ break; ++ default: ++ /* consume if rex */ ++ done = (u->dis_mode == 64 && (curr & 0xF0) == 0x40) ? 0 : 1; ++ break; ++ } ++ } while (!done); ++ /* rex prefixes in 64bit mode, must be the last prefix */ ++ if (u->dis_mode == 64 && (last & 0xF0) == 0x40) { ++ u->pfx_rex = last; ++ } ++ return 0; ++} + +- /* return status */ +- if ( u->error ) +- return -1; + +- /* rewind back one byte in stream, since the above loop +- * stops with a non-prefix byte. +- */ +- ud_inp_back(u); +- return 0; ++/* ++ * vex_l, vex_w ++ * Return the vex.L and vex.W bits ++ */ ++static UD_INLINE uint8_t ++vex_l(const struct ud *u) ++{ ++ UD_ASSERT(u->vex_op != 0); ++ return ((u->vex_op == 0xc4 ? u->vex_b2 : u->vex_b1) >> 2) & 1; + } + ++static UD_INLINE uint8_t ++vex_w(const struct ud *u) ++{ ++ UD_ASSERT(u->vex_op != 0); ++ return u->vex_op == 0xc4 ? ((u->vex_b2 >> 7) & 1) : 0; ++} + +-static inline unsigned int modrm( struct ud * u ) ++ ++static UD_INLINE uint8_t ++modrm(struct ud * u) + { + if ( !u->have_modrm ) { +- u->modrm = ud_inp_next( u ); ++ u->modrm = inp_next( u ); ++ u->modrm_offset = (uint8_t) (u->inp_ctr - 1); + u->have_modrm = 1; + } + return u->modrm; + } + + +-static unsigned int resolve_operand_size( const struct ud * u, unsigned int s ) ++static unsigned int ++resolve_operand_size(const struct ud* u, ud_operand_size_t osize) + { +- switch ( s ) +- { +- case SZ_V: +- return ( u->opr_mode ); +- case SZ_Z: +- return ( u->opr_mode == 16 ) ? 16 : 32; +- case SZ_P: +- return ( u->opr_mode == 16 ) ? SZ_WP : SZ_DP; +- case SZ_MDQ: +- return ( u->opr_mode == 16 ) ? 32 : u->opr_mode; +- case SZ_RDQ: +- return ( u->dis_mode == 64 ) ? 64 : 32; +- default: +- return s; +- } ++ switch (osize) { ++ case SZ_V: ++ return u->opr_mode; ++ case SZ_Z: ++ return u->opr_mode == 16 ? 16 : 32; ++ case SZ_Y: ++ return u->opr_mode == 16 ? 32 : u->opr_mode; ++ case SZ_RDQ: ++ return u->dis_mode == 64 ? 64 : 32; ++ case SZ_X: ++ UD_ASSERT(u->vex_op != 0); ++ return (P_VEXL(u->itab_entry->prefix) && vex_l(u)) ? SZ_QQ : SZ_DQ; ++ default: ++ return osize; ++ } + } + + + static int resolve_mnemonic( struct ud* u ) + { +- /* far/near flags */ +- u->br_far = 0; +- u->br_near = 0; +- /* readjust operand sizes for call/jmp instrcutions */ +- if ( u->mnemonic == UD_Icall || u->mnemonic == UD_Ijmp ) { +- /* WP: 16:16 pointer */ +- if ( u->operand[ 0 ].size == SZ_WP ) { +- u->operand[ 0 ].size = 16; +- u->br_far = 1; +- u->br_near= 0; +- /* DP: 32:32 pointer */ +- } else if ( u->operand[ 0 ].size == SZ_DP ) { +- u->operand[ 0 ].size = 32; +- u->br_far = 1; +- u->br_near= 0; +- } else { +- u->br_far = 0; +- u->br_near= 1; +- } + /* resolve 3dnow weirdness. */ +- } else if ( u->mnemonic == UD_I3dnow ) { +- u->mnemonic = ud_itab[ u->le->table[ ud_inp_curr( u ) ] ].mnemonic; ++ if ( u->mnemonic == UD_I3dnow ) { ++ u->mnemonic = ud_itab[ u->le->table[ inp_curr( u ) ] ].mnemonic; + } + /* SWAPGS is only valid in 64bits mode */ + if ( u->mnemonic == UD_Iswapgs && u->dis_mode != 64 ) { +- u->error = 1; ++ UDERR(u, "swapgs invalid in 64bits mode\n"); + return -1; + } + +@@ -269,8 +369,8 @@ + } + } + +- if (u->mnemonic == UD_Inop && u->pfx_rep) { +- u->pfx_rep = 0; ++ if (u->mnemonic == UD_Inop && u->pfx_repe) { ++ u->pfx_repe = 0; + u->mnemonic = UD_Ipause; + } + return 0; +@@ -288,14 +388,14 @@ + /* seg16:off16 */ + op->type = UD_OP_PTR; + op->size = 32; +- op->lval.ptr.off = ud_inp_uint16(u); +- op->lval.ptr.seg = ud_inp_uint16(u); ++ op->lval.ptr.off = inp_uint16(u); ++ op->lval.ptr.seg = inp_uint16(u); + } else { + /* seg16:off32 */ + op->type = UD_OP_PTR; + op->size = 48; +- op->lval.ptr.off = ud_inp_uint32(u); +- op->lval.ptr.seg = ud_inp_uint16(u); ++ op->lval.ptr.off = inp_uint32(u); ++ op->lval.ptr.seg = inp_uint16(u); + } + } + +@@ -306,15 +406,11 @@ + static enum ud_type + decode_gpr(register struct ud* u, unsigned int s, unsigned char rm) + { +- s = resolve_operand_size(u, s); +- + switch (s) { + case 64: + return UD_R_RAX + rm; +- case SZ_DP: + case 32: + return UD_R_EAX + rm; +- case SZ_WP: + case 16: + return UD_R_AX + rm; + case 8: +@@ -323,94 +419,103 @@ + return UD_R_SPL + (rm-4); + return UD_R_AL + rm; + } else return UD_R_AL + rm; ++ case 0: ++ /* invalid size in case of a decode error */ ++ UD_ASSERT(u->error); ++ return UD_NONE; + default: +- return 0; +- } +-} +- +-/* ----------------------------------------------------------------------------- +- * resolve_gpr64() - 64bit General Purpose Register-Selection. +- * ----------------------------------------------------------------------------- +- */ +-static enum ud_type +-resolve_gpr64(struct ud* u, enum ud_operand_code gpr_op, enum ud_operand_size * size) +-{ +- if (gpr_op >= OP_rAXr8 && gpr_op <= OP_rDIr15) +- gpr_op = (gpr_op - OP_rAXr8) | (REX_B(u->pfx_rex) << 3); +- else gpr_op = (gpr_op - OP_rAX); +- +- if (u->opr_mode == 16) { +- *size = 16; +- return gpr_op + UD_R_AX; ++ UD_ASSERT(!"invalid operand size"); ++ return UD_NONE; + } +- if (u->dis_mode == 32 || +- (u->opr_mode == 32 && ! (REX_W(u->pfx_rex) || u->default64))) { +- *size = 32; +- return gpr_op + UD_R_EAX; +- } +- +- *size = 64; +- return gpr_op + UD_R_RAX; + } + +-/* ----------------------------------------------------------------------------- +- * resolve_gpr32 () - 32bit General Purpose Register-Selection. +- * ----------------------------------------------------------------------------- +- */ +-static enum ud_type +-resolve_gpr32(struct ud* u, enum ud_operand_code gpr_op) +-{ +- gpr_op = gpr_op - OP_eAX; +- +- if (u->opr_mode == 16) +- return gpr_op + UD_R_AX; +- +- return gpr_op + UD_R_EAX; +-} +- +-/* ----------------------------------------------------------------------------- +- * resolve_reg() - Resolves the register type +- * ----------------------------------------------------------------------------- +- */ +-static enum ud_type +-resolve_reg(struct ud* u, unsigned int type, unsigned char i) ++static void ++decode_reg(struct ud *u, ++ struct ud_operand *opr, ++ int type, ++ int num, ++ int size) + { ++ int reg; ++ size = resolve_operand_size(u, size); + switch (type) { +- case T_MMX : return UD_R_MM0 + (i & 7); +- case T_XMM : return UD_R_XMM0 + i; +- case T_CRG : return UD_R_CR0 + i; +- case T_DBG : return UD_R_DR0 + i; +- case T_SEG : { ++ case REGCLASS_GPR : reg = decode_gpr(u, size, num); break; ++ case REGCLASS_MMX : reg = UD_R_MM0 + (num & 7); break; ++ case REGCLASS_XMM : ++ reg = num + (size == SZ_QQ ? UD_R_YMM0 : UD_R_XMM0); ++ break; ++ case REGCLASS_CR : reg = UD_R_CR0 + num; break; ++ case REGCLASS_DB : reg = UD_R_DR0 + num; break; ++ case REGCLASS_SEG : { + /* + * Only 6 segment registers, anything else is an error. + */ +- if ((i & 7) > 5) { +- u->error = 1; ++ if ((num & 7) > 5) { ++ UDERR(u, "invalid segment register value\n"); ++ return; + } else { +- return UD_R_ES + (i & 7); ++ reg = UD_R_ES + (num & 7); + } ++ break; + } +- case T_NONE: +- default: return UD_NONE; ++ default: ++ UD_ASSERT(!"invalid register type"); ++ return; + } ++ opr->type = UD_OP_REG; ++ opr->base = reg; ++ opr->size = size; + } + +-/* ----------------------------------------------------------------------------- +- * decode_imm() - Decodes Immediate values. +- * ----------------------------------------------------------------------------- ++ ++/* ++ * decode_imm ++ * ++ * Decode Immediate values. + */ + static void +-decode_imm(struct ud* u, unsigned int s, struct ud_operand *op) ++decode_imm(struct ud* u, unsigned int size, struct ud_operand *op) + { +- op->size = resolve_operand_size(u, s); ++ op->size = resolve_operand_size(u, size); + op->type = UD_OP_IMM; + + switch (op->size) { +- case 8: op->lval.sbyte = ud_inp_uint8(u); break; +- case 16: op->lval.uword = ud_inp_uint16(u); break; +- case 32: op->lval.udword = ud_inp_uint32(u); break; +- case 64: op->lval.uqword = ud_inp_uint64(u); break; +- default: return; ++ case 8: op->lval.sbyte = inp_uint8(u); break; ++ case 16: op->lval.uword = inp_uint16(u); break; ++ case 32: op->lval.udword = inp_uint32(u); break; ++ case 64: op->lval.uqword = inp_uint64(u); break; ++ default: return; ++ } ++} ++ ++ ++/* ++ * decode_mem_disp ++ * ++ * Decode mem address displacement. ++ */ ++static void ++decode_mem_disp(struct ud* u, unsigned int size, struct ud_operand *op) ++{ ++ switch (size) { ++ case 8: ++ op->offset = 8; ++ op->lval.ubyte = inp_uint8(u); ++ break; ++ case 16: ++ op->offset = 16; ++ op->lval.uword = inp_uint16(u); ++ break; ++ case 32: ++ op->offset = 32; ++ op->lval.udword = inp_uint32(u); ++ break; ++ case 64: ++ op->offset = 64; ++ op->lval.uqword = inp_uint64(u); ++ break; ++ default: ++ return; + } + } + +@@ -421,21 +526,14 @@ + * Decodes reg field of mod/rm byte + * + */ +-static void ++static UD_INLINE void + decode_modrm_reg(struct ud *u, + struct ud_operand *operand, + unsigned int type, + unsigned int size) + { +- uint8_t reg = (REX_R(u->pfx_rex) << 3) | MODRM_REG(modrm(u)); +- operand->type = UD_OP_REG; +- operand->size = resolve_operand_size(u, size); +- +- if (type == T_GPR) { +- operand->base = decode_gpr(u, operand->size, reg); +- } else { +- operand->base = resolve_reg(u, type, reg); +- } ++ uint8_t reg = (REX_R(u->_rex) << 3) | MODRM_REG(modrm(u)); ++ decode_reg(u, operand, type, reg, size); + } + + +@@ -448,67 +546,58 @@ + static void + decode_modrm_rm(struct ud *u, + struct ud_operand *op, +- unsigned char type, +- unsigned int size) ++ unsigned char type, /* register type */ ++ unsigned int size) /* operand size */ + + { +- unsigned char mod, rm, reg; ++ size_t offset = 0; ++ unsigned char mod, rm; + + /* get mod, r/m and reg fields */ + mod = MODRM_MOD(modrm(u)); +- rm = (REX_B(u->pfx_rex) << 3) | MODRM_RM(modrm(u)); +- reg = (REX_R(u->pfx_rex) << 3) | MODRM_REG(modrm(u)); +- +- UNUSED_PARAM(reg); +- +- op->size = resolve_operand_size(u, size); ++ rm = (REX_B(u->_rex) << 3) | MODRM_RM(modrm(u)); + + /* + * If mod is 11b, then the modrm.rm specifies a register. + * + */ + if (mod == 3) { +- op->type = UD_OP_REG; +- if (type == T_GPR) { +- op->base = decode_gpr(u, op->size, rm); +- } else { +- op->base = resolve_reg(u, type, (REX_B(u->pfx_rex) << 3) | (rm & 7)); +- } ++ decode_reg(u, op, type, rm, size); + return; +- } +- ++ } + + /* +- * !11 => Memory Address ++ * !11b => Memory Address + */ + op->type = UD_OP_MEM; ++ op->size = resolve_operand_size(u, size); + + if (u->adr_mode == 64) { + op->base = UD_R_RAX + rm; + if (mod == 1) { +- op->offset = 8; ++ offset = 8; + } else if (mod == 2) { +- op->offset = 32; ++ offset = 32; + } else if (mod == 0 && (rm & 7) == 5) { + op->base = UD_R_RIP; +- op->offset = 32; ++ offset = 32; + } else { +- op->offset = 0; ++ offset = 0; + } + /* + * Scale-Index-Base (SIB) + */ + if ((rm & 7) == 4) { +- ud_inp_next(u); ++ inp_next(u); + +- op->scale = (1 << SIB_S(ud_inp_curr(u))) & ~1; +- op->index = UD_R_RAX + (SIB_I(ud_inp_curr(u)) | (REX_X(u->pfx_rex) << 3)); +- op->base = UD_R_RAX + (SIB_B(ud_inp_curr(u)) | (REX_B(u->pfx_rex) << 3)); +- ++ op->base = UD_R_RAX + (SIB_B(inp_curr(u)) | (REX_B(u->_rex) << 3)); ++ op->index = UD_R_RAX + (SIB_I(inp_curr(u)) | (REX_X(u->_rex) << 3)); + /* special conditions for base reference */ + if (op->index == UD_R_RSP) { + op->index = UD_NONE; + op->scale = UD_NONE; ++ } else { ++ op->scale = (1 << SIB_S(inp_curr(u))) & ~1; + } + + if (op->base == UD_R_RBP || op->base == UD_R_R13) { +@@ -516,32 +605,35 @@ + op->base = UD_NONE; + } + if (mod == 1) { +- op->offset = 8; ++ offset = 8; + } else { +- op->offset = 32; ++ offset = 32; + } + } ++ } else { ++ op->scale = UD_NONE; ++ op->index = UD_NONE; + } + } else if (u->adr_mode == 32) { + op->base = UD_R_EAX + rm; + if (mod == 1) { +- op->offset = 8; ++ offset = 8; + } else if (mod == 2) { +- op->offset = 32; ++ offset = 32; + } else if (mod == 0 && rm == 5) { + op->base = UD_NONE; +- op->offset = 32; ++ offset = 32; + } else { +- op->offset = 0; ++ offset = 0; + } + + /* Scale-Index-Base (SIB) */ + if ((rm & 7) == 4) { +- ud_inp_next(u); ++ inp_next(u); + +- op->scale = (1 << SIB_S(ud_inp_curr(u))) & ~1; +- op->index = UD_R_EAX + (SIB_I(ud_inp_curr(u)) | (REX_X(u->pfx_rex) << 3)); +- op->base = UD_R_EAX + (SIB_B(ud_inp_curr(u)) | (REX_B(u->pfx_rex) << 3)); ++ op->scale = (1 << SIB_S(inp_curr(u))) & ~1; ++ op->index = UD_R_EAX + (SIB_I(inp_curr(u)) | (REX_X(u->pfx_rex) << 3)); ++ op->base = UD_R_EAX + (SIB_B(inp_curr(u)) | (REX_B(u->pfx_rex) << 3)); + + if (op->index == UD_R_ESP) { + op->index = UD_NONE; +@@ -554,11 +646,14 @@ + op->base = UD_NONE; + } + if (mod == 1) { +- op->offset = 8; ++ offset = 8; + } else { +- op->offset = 32; ++ offset = 32; + } + } ++ } else { ++ op->scale = UD_NONE; ++ op->index = UD_NONE; + } + } else { + const unsigned int bases[] = { UD_R_BX, UD_R_BX, UD_R_BP, UD_R_BP, +@@ -567,58 +662,72 @@ + UD_NONE, UD_NONE, UD_NONE, UD_NONE }; + op->base = bases[rm & 7]; + op->index = indices[rm & 7]; ++ op->scale = UD_NONE; + if (mod == 0 && rm == 6) { +- op->offset= 16; ++ offset = 16; + op->base = UD_NONE; + } else if (mod == 1) { +- op->offset = 8; ++ offset = 8; + } else if (mod == 2) { +- op->offset = 16; ++ offset = 16; + } + } + +- /* +- * extract offset, if any +- */ +- switch (op->offset) { +- case 8 : op->lval.ubyte = ud_inp_uint8(u); break; +- case 16: op->lval.uword = ud_inp_uint16(u); break; +- case 32: op->lval.udword = ud_inp_uint32(u); break; +- case 64: op->lval.uqword = ud_inp_uint64(u); break; +- default: break; ++ if (offset) { ++ decode_mem_disp(u, offset, op); ++ } else { ++ op->offset = 0; + } + } + +-/* ----------------------------------------------------------------------------- +- * decode_o() - Decodes offset +- * ----------------------------------------------------------------------------- ++ ++/* ++ * decode_moffset ++ * Decode offset-only memory operand + */ +-static void +-decode_o(struct ud* u, unsigned int s, struct ud_operand *op) ++static void ++decode_moffset(struct ud *u, unsigned int size, struct ud_operand *opr) + { +- switch (u->adr_mode) { +- case 64: +- op->offset = 64; +- op->lval.uqword = ud_inp_uint64(u); +- break; +- case 32: +- op->offset = 32; +- op->lval.udword = ud_inp_uint32(u); +- break; +- case 16: +- op->offset = 16; +- op->lval.uword = ud_inp_uint16(u); +- break; +- default: +- return; +- } +- op->type = UD_OP_MEM; +- op->size = resolve_operand_size(u, s); ++ opr->type = UD_OP_MEM; ++ opr->base = UD_NONE; ++ opr->index = UD_NONE; ++ opr->scale = UD_NONE; ++ opr->size = resolve_operand_size(u, size); ++ decode_mem_disp(u, u->adr_mode, opr); + } + +-/* ----------------------------------------------------------------------------- +- * decode_operands() - Disassembles Operands. +- * ----------------------------------------------------------------------------- ++ ++static void ++decode_vex_vvvv(struct ud *u, struct ud_operand *opr, unsigned size) ++{ ++ uint8_t vvvv; ++ UD_ASSERT(u->vex_op != 0); ++ vvvv = ((u->vex_op == 0xc4 ? u->vex_b2 : u->vex_b1) >> 3) & 0xf; ++ decode_reg(u, opr, REGCLASS_XMM, (0xf & ~vvvv), size); ++} ++ ++ ++/* ++ * decode_vex_immreg ++ * Decode source operand encoded in immediate byte [7:4] ++ */ ++static int ++decode_vex_immreg(struct ud *u, struct ud_operand *opr, unsigned size) ++{ ++ uint8_t imm = inp_next(u); ++ uint8_t mask = u->dis_mode == 64 ? 0xf : 0x7; ++ UD_RETURN_ON_ERROR(u); ++ UD_ASSERT(u->vex_op != 0); ++ decode_reg(u, opr, REGCLASS_XMM, mask & (imm >> 4), size); ++ return 0; ++} ++ ++ ++/* ++ * decode_operand ++ * ++ * Decodes a single operand. ++ * Returns the type of the operand (UD_NONE if none) + */ + static int + decode_operand(struct ud *u, +@@ -626,35 +735,33 @@ + enum ud_operand_code type, + unsigned int size) + { ++ operand->type = UD_NONE; ++ operand->_oprcode = type; ++ + switch (type) { + case OP_A : + decode_a(u, operand); + break; + case OP_MR: +- if (MODRM_MOD(modrm(u)) == 3) { +- decode_modrm_rm(u, operand, T_GPR, +- size == SZ_DY ? SZ_MDQ : SZ_V); +- } else if (size == SZ_WV) { +- decode_modrm_rm( u, operand, T_GPR, SZ_W); +- } else if (size == SZ_BV) { +- decode_modrm_rm( u, operand, T_GPR, SZ_B); +- } else if (size == SZ_DY) { +- decode_modrm_rm( u, operand, T_GPR, SZ_D); +- } else { +- ASSERT(!"unexpected size"); +- } ++ decode_modrm_rm(u, operand, REGCLASS_GPR, ++ MODRM_MOD(modrm(u)) == 3 ? ++ Mx_reg_size(size) : Mx_mem_size(size)); + break; ++ case OP_F: ++ u->br_far = 1; ++ /* intended fall through */ + case OP_M: + if (MODRM_MOD(modrm(u)) == 3) { +- u->error = 1; ++ UDERR(u, "expected modrm.mod != 3\n"); + } + /* intended fall through */ + case OP_E: +- decode_modrm_rm(u, operand, T_GPR, size); ++ decode_modrm_rm(u, operand, REGCLASS_GPR, size); + break; + case OP_G: +- decode_modrm_reg(u, operand, T_GPR, size); ++ decode_modrm_reg(u, operand, REGCLASS_GPR, size); + break; ++ case OP_sI: + case OP_I: + decode_imm(u, size, operand); + break; +@@ -662,96 +769,68 @@ + operand->type = UD_OP_CONST; + operand->lval.udword = 1; + break; +- case OP_PR: ++ case OP_N: + if (MODRM_MOD(modrm(u)) != 3) { +- u->error = 1; ++ UDERR(u, "expected modrm.mod == 3\n"); + } +- decode_modrm_rm(u, operand, T_MMX, size); ++ /* intended fall through */ ++ case OP_Q: ++ decode_modrm_rm(u, operand, REGCLASS_MMX, size); + break; + case OP_P: +- decode_modrm_reg(u, operand, T_MMX, size); ++ decode_modrm_reg(u, operand, REGCLASS_MMX, size); + break; +- case OP_VR: ++ case OP_U: + if (MODRM_MOD(modrm(u)) != 3) { +- u->error = 1; ++ UDERR(u, "expected modrm.mod == 3\n"); + } + /* intended fall through */ + case OP_W: +- decode_modrm_rm(u, operand, T_XMM, size); ++ decode_modrm_rm(u, operand, REGCLASS_XMM, size); + break; + case OP_V: +- decode_modrm_reg(u, operand, T_XMM, size); ++ decode_modrm_reg(u, operand, REGCLASS_XMM, size); + break; +- case OP_S: +- decode_modrm_reg(u, operand, T_SEG, size); ++ case OP_H: ++ decode_vex_vvvv(u, operand, size); + break; +- case OP_AL: +- case OP_CL: +- case OP_DL: +- case OP_BL: +- case OP_AH: +- case OP_CH: +- case OP_DH: +- case OP_BH: +- operand->type = UD_OP_REG; +- operand->base = UD_R_AL + (type - OP_AL); +- operand->size = 8; ++ case OP_MU: ++ decode_modrm_rm(u, operand, REGCLASS_XMM, ++ MODRM_MOD(modrm(u)) == 3 ? ++ Mx_reg_size(size) : Mx_mem_size(size)); + break; +- case OP_DX: +- operand->type = UD_OP_REG; +- operand->base = UD_R_DX; +- operand->size = 16; ++ case OP_S: ++ decode_modrm_reg(u, operand, REGCLASS_SEG, size); + break; + case OP_O: +- decode_o(u, size, operand); ++ decode_moffset(u, size, operand); + break; +- case OP_rAXr8: +- case OP_rCXr9: +- case OP_rDXr10: +- case OP_rBXr11: +- case OP_rSPr12: +- case OP_rBPr13: +- case OP_rSIr14: +- case OP_rDIr15: +- case OP_rAX: +- case OP_rCX: +- case OP_rDX: +- case OP_rBX: +- case OP_rSP: +- case OP_rBP: +- case OP_rSI: +- case OP_rDI: +- operand->type = UD_OP_REG; +- operand->base = resolve_gpr64(u, type, &operand->size); ++ case OP_R0: ++ case OP_R1: ++ case OP_R2: ++ case OP_R3: ++ case OP_R4: ++ case OP_R5: ++ case OP_R6: ++ case OP_R7: ++ decode_reg(u, operand, REGCLASS_GPR, ++ (REX_B(u->_rex) << 3) | (type - OP_R0), size); + break; +- case OP_ALr8b: +- case OP_CLr9b: +- case OP_DLr10b: +- case OP_BLr11b: +- case OP_AHr12b: +- case OP_CHr13b: +- case OP_DHr14b: +- case OP_BHr15b: { +- ud_type_t gpr = (type - OP_ALr8b) + UD_R_AL +- + (REX_B(u->pfx_rex) << 3); +- if (UD_R_AH <= gpr && u->pfx_rex) { +- gpr = gpr + 4; +- } +- operand->type = UD_OP_REG; +- operand->base = gpr; ++ case OP_AL: ++ case OP_AX: ++ case OP_eAX: ++ case OP_rAX: ++ decode_reg(u, operand, REGCLASS_GPR, 0, size); + break; +- } +- case OP_eAX: +- case OP_eCX: +- case OP_eDX: +- case OP_eBX: +- case OP_eSP: +- case OP_eBP: +- case OP_eSI: +- case OP_eDI: +- operand->type = UD_OP_REG; +- operand->base = resolve_gpr32(u, type); +- operand->size = u->opr_mode == 16 ? 16 : 32; ++ case OP_CL: ++ case OP_CX: ++ case OP_eCX: ++ decode_reg(u, operand, REGCLASS_GPR, 1, size); ++ break; ++ case OP_DL: ++ case OP_DX: ++ case OP_eDX: ++ decode_reg(u, operand, REGCLASS_GPR, 2, size); + break; + case OP_ES: + case OP_CS: +@@ -762,7 +841,7 @@ + /* in 64bits mode, only fs and gs are allowed */ + if (u->dis_mode == 64) { + if (type != OP_FS && type != OP_GS) { +- u->error= 1; ++ UDERR(u, "invalid segment register in 64bits\n"); + } + } + operand->type = UD_OP_REG; +@@ -773,17 +852,17 @@ + decode_imm(u, size, operand); + operand->type = UD_OP_JIMM; + break ; +- case OP_Q: +- decode_modrm_rm(u, operand, T_MMX, size); +- break; + case OP_R : +- decode_modrm_rm(u, operand, T_GPR, size); ++ if (MODRM_MOD(modrm(u)) != 3) { ++ UDERR(u, "expected modrm.mod == 3\n"); ++ } ++ decode_modrm_rm(u, operand, REGCLASS_GPR, size); + break; + case OP_C: +- decode_modrm_reg(u, operand, T_CRG, size); ++ decode_modrm_reg(u, operand, REGCLASS_CR, size); + break; + case OP_D: +- decode_modrm_reg(u, operand, T_DBG, size); ++ decode_modrm_reg(u, operand, REGCLASS_DB, size); + break; + case OP_I3 : + operand->type = UD_OP_CONST; +@@ -799,18 +878,16 @@ + case OP_ST7: + operand->type = UD_OP_REG; + operand->base = (type - OP_ST0) + UD_R_ST0; +- operand->size = 0; ++ operand->size = 80; + break; +- case OP_AX: +- operand->type = UD_OP_REG; +- operand->base = UD_R_AX; +- operand->size = 16; ++ case OP_L: ++ decode_vex_immreg(u, operand, size); + break; + default : + operand->type = UD_NONE; + break; + } +- return 0; ++ return operand->type; + } + + +@@ -827,12 +904,21 @@ + decode_operand(u, &u->operand[0], + u->itab_entry->operand1.type, + u->itab_entry->operand1.size); +- decode_operand(u, &u->operand[1], +- u->itab_entry->operand2.type, +- u->itab_entry->operand2.size); +- decode_operand(u, &u->operand[2], +- u->itab_entry->operand3.type, +- u->itab_entry->operand3.size); ++ if (u->operand[0].type != UD_NONE) { ++ decode_operand(u, &u->operand[1], ++ u->itab_entry->operand2.type, ++ u->itab_entry->operand2.size); ++ } ++ if (u->operand[1].type != UD_NONE) { ++ decode_operand(u, &u->operand[2], ++ u->itab_entry->operand3.type, ++ u->itab_entry->operand3.size); ++ } ++ if (u->operand[2].type != UD_NONE) { ++ decode_operand(u, &u->operand[3], ++ u->itab_entry->operand4.type, ++ u->itab_entry->operand4.size); ++ } + return 0; + } + +@@ -852,19 +938,40 @@ + u->pfx_rep = 0; + u->pfx_repe = 0; + u->pfx_rex = 0; +- u->pfx_insn = 0; ++ u->pfx_str = 0; + u->mnemonic = UD_Inone; + u->itab_entry = NULL; + u->have_modrm = 0; ++ u->br_far = 0; ++ u->vex_op = 0; ++ u->_rex = 0; ++ u->operand[0].type = UD_NONE; ++ u->operand[1].type = UD_NONE; ++ u->operand[2].type = UD_NONE; ++ u->operand[3].type = UD_NONE; ++} + +- memset( &u->operand[ 0 ], 0, sizeof( struct ud_operand ) ); +- memset( &u->operand[ 1 ], 0, sizeof( struct ud_operand ) ); +- memset( &u->operand[ 2 ], 0, sizeof( struct ud_operand ) ); ++ ++static UD_INLINE int ++resolve_pfx_str(struct ud* u) ++{ ++ if (u->pfx_str == 0xf3) { ++ if (P_STR(u->itab_entry->prefix)) { ++ u->pfx_rep = 0xf3; ++ } else { ++ u->pfx_repe = 0xf3; ++ } ++ } else if (u->pfx_str == 0xf2) { ++ u->pfx_repne = 0xf3; ++ } ++ return 0; + } + ++ + static int + resolve_mode( struct ud* u ) + { ++ int default64; + /* if in error state, bail out */ + if ( u->error ) return -1; + +@@ -873,22 +980,34 @@ + + /* Check validity of instruction m64 */ + if ( P_INV64( u->itab_entry->prefix ) ) { +- u->error = 1; +- return -1; ++ UDERR(u, "instruction invalid in 64bits\n"); ++ return -1; + } + +- /* effective rex prefix is the effective mask for the +- * instruction hard-coded in the opcode map. ++ /* compute effective rex based on, ++ * - vex prefix (if any) ++ * - rex prefix (if any, and not vex) ++ * - allowed prefixes specified by the opcode map + */ +- u->pfx_rex = ( u->pfx_rex & 0x40 ) | +- ( u->pfx_rex & REX_PFX_MASK( u->itab_entry->prefix ) ); ++ if (u->vex_op == 0xc4) { ++ /* vex has rex.rxb in 1's complement */ ++ u->_rex = ((~(u->vex_b1 >> 5) & 0x7) /* rex.0rxb */ | ++ ((u->vex_b2 >> 4) & 0x8) /* rex.w000 */); ++ } else if (u->vex_op == 0xc5) { ++ /* vex has rex.r in 1's complement */ ++ u->_rex = (~(u->vex_b1 >> 5)) & 4; ++ } else { ++ UD_ASSERT(u->vex_op == 0); ++ u->_rex = u->pfx_rex; ++ } ++ u->_rex &= REX_PFX_MASK(u->itab_entry->prefix); + + /* whether this instruction has a default operand size of + * 64bit, also hardcoded into the opcode map. + */ +- u->default64 = P_DEF64( u->itab_entry->prefix ); ++ default64 = P_DEF64( u->itab_entry->prefix ); + /* calculate effective operand size */ +- if ( REX_W( u->pfx_rex ) ) { ++ if (REX_W(u->_rex)) { + u->opr_mode = 64; + } else if ( u->pfx_opr ) { + u->opr_mode = 16; +@@ -897,7 +1016,7 @@ + * the effective operand size in the absence of rex.w + * prefix is 32. + */ +- u->opr_mode = ( u->default64 ) ? 64 : 32; ++ u->opr_mode = default64 ? 64 : 32; + } + + /* calculate effective address size */ +@@ -910,45 +1029,18 @@ + u->adr_mode = ( u->pfx_adr ) ? 32 : 16; + } + +- /* These flags determine which operand to apply the operand size +- * cast to. +- */ +- u->c1 = ( P_C1( u->itab_entry->prefix ) ) ? 1 : 0; +- u->c2 = ( P_C2( u->itab_entry->prefix ) ) ? 1 : 0; +- u->c3 = ( P_C3( u->itab_entry->prefix ) ) ? 1 : 0; +- +- /* set flags for implicit addressing */ +- u->implicit_addr = P_IMPADDR( u->itab_entry->prefix ); +- + return 0; + } + +-static int gen_hex( struct ud *u ) +-{ +- unsigned int i; +- unsigned char *src_ptr = ud_inp_sess( u ); +- char* src_hex; + +- /* bail out if in error stat. */ +- if ( u->error ) return -1; +- /* output buffer pointe */ +- src_hex = ( char* ) u->insn_hexcode; +- /* for each byte used to decode instruction */ +- for ( i = 0; i < u->inp_ctr; ++i, ++src_ptr) { +- sprintf( src_hex, "%02x", *src_ptr & 0xFF ); +- src_hex += 2; +- } +- return 0; +-} +- +- +-static inline int ++static UD_INLINE int + decode_insn(struct ud *u, uint16_t ptr) + { +- ASSERT((ptr & 0x8000) == 0); ++ UD_ASSERT((ptr & 0x8000) == 0); + u->itab_entry = &ud_itab[ ptr ]; + u->mnemonic = u->itab_entry->mnemonic; +- return (resolve_mode(u) == 0 && ++ return (resolve_pfx_str(u) == 0 && ++ resolve_mode(u) == 0 && + decode_operands(u) == 0 && + resolve_mnemonic(u) == 0) ? 0 : -1; + } +@@ -965,19 +1057,19 @@ + * valid entry in the table, decode the operands, and read the final + * byte to resolve the menmonic. + */ +-static inline int ++static UD_INLINE int + decode_3dnow(struct ud* u) + { + uint16_t ptr; +- ASSERT(u->le->type == UD_TAB__OPC_3DNOW); +- ASSERT(u->le->table[0xc] != 0); ++ UD_ASSERT(u->le->type == UD_TAB__OPC_3DNOW); ++ UD_ASSERT(u->le->table[0xc] != 0); + decode_insn(u, u->le->table[0xc]); +- ud_inp_next(u); ++ inp_next(u); + if (u->error) { + return -1; + } +- ptr = u->le->table[ud_inp_curr(u)]; +- ASSERT((ptr & 0x8000) == 0); ++ ptr = u->le->table[inp_curr(u)]; ++ UD_ASSERT((ptr & 0x8000) == 0); + u->mnemonic = ud_itab[ptr].mnemonic; + return 0; + } +@@ -986,7 +1078,18 @@ + static int + decode_ssepfx(struct ud *u) + { +- uint8_t idx = ((u->pfx_insn & 0xf) + 1) / 2; ++ uint8_t idx; ++ uint8_t pfx; ++ ++ /* ++ * String prefixes (f2, f3) take precedence over operand ++ * size prefix (66). ++ */ ++ pfx = u->pfx_str; ++ if (pfx == 0) { ++ pfx = u->pfx_opr; ++ } ++ idx = ((pfx & 0xf) + 1) / 2; + if (u->le->table[idx] == 0) { + idx = 0; + } +@@ -995,23 +1098,50 @@ + * "Consume" the prefix as a part of the opcode, so it is no + * longer exported as an instruction prefix. + */ +- switch (u->pfx_insn) { +- case 0xf2: +- u->pfx_repne = 0; +- break; +- case 0xf3: +- u->pfx_rep = 0; +- u->pfx_repe = 0; +- break; +- case 0x66: ++ u->pfx_str = 0; ++ if (pfx == 0x66) { ++ /* ++ * consume "66" only if it was used for decoding, leaving ++ * it to be used as an operands size override for some ++ * simd instructions. ++ */ + u->pfx_opr = 0; +- break; + } + } + return decode_ext(u, u->le->table[idx]); + } + + ++static int ++decode_vex(struct ud *u) ++{ ++ uint8_t index; ++ if (u->dis_mode != 64 && MODRM_MOD(inp_peek(u)) != 0x3) { ++ index = 0; ++ } else { ++ u->vex_op = inp_curr(u); ++ u->vex_b1 = inp_next(u); ++ if (u->vex_op == 0xc4) { ++ uint8_t pp, m; ++ /* 3-byte vex */ ++ u->vex_b2 = inp_next(u); ++ UD_RETURN_ON_ERROR(u); ++ m = u->vex_b1 & 0x1f; ++ if (m == 0 || m > 3) { ++ UD_RETURN_WITH_ERROR(u, "reserved vex.m-mmmm value"); ++ } ++ pp = u->vex_b2 & 0x3; ++ index = (pp << 2) | m; ++ } else { ++ /* 2-byte vex */ ++ UD_ASSERT(u->vex_op == 0xc5); ++ index = 0x1 | ((u->vex_b1 & 0x3) << 2); ++ } ++ } ++ return decode_ext(u, u->le->table[index]); ++} ++ ++ + /* + * decode_ext() + * +@@ -1038,7 +1168,7 @@ + * 16 = 0,, 32 = 1, 64 = 2 + */ + case UD_TAB__OPC_MODE: +- idx = u->dis_mode / 32; ++ idx = u->dis_mode != 64 ? 0 : 1; + break; + case UD_TAB__OPC_OSIZE: + idx = eff_opr_mode(u->dis_mode, REX_W(u->pfx_rex), u->pfx_opr) / 32; +@@ -1067,8 +1197,19 @@ + break; + case UD_TAB__OPC_SSE: + return decode_ssepfx(u); ++ case UD_TAB__OPC_VEX: ++ return decode_vex(u); ++ case UD_TAB__OPC_VEX_W: ++ idx = vex_w(u); ++ break; ++ case UD_TAB__OPC_VEX_L: ++ idx = vex_l(u); ++ break; ++ case UD_TAB__OPC_TABLE: ++ inp_next(u); ++ return decode_opcode(u); + default: +- ASSERT(!"not reached"); ++ UD_ASSERT(!"not reached"); + break; + } + +@@ -1076,22 +1217,13 @@ + } + + +-static inline int ++static int + decode_opcode(struct ud *u) + { + uint16_t ptr; +- ASSERT(u->le->type == UD_TAB__OPC_TABLE); +- ud_inp_next(u); +- if (u->error) { +- return -1; +- } +- ptr = u->le->table[ud_inp_curr(u)]; +- if (ptr & 0x8000) { +- u->le = &ud_lookup_table_list[ptr & ~0x8000]; +- if (u->le->type == UD_TAB__OPC_TABLE) { +- return decode_opcode(u); +- } +- } ++ UD_ASSERT(u->le->type == UD_TAB__OPC_TABLE); ++ UD_RETURN_ON_ERROR(u); ++ ptr = u->le->table[inp_curr(u)]; + return decode_ext(u, ptr); + } + +@@ -1103,7 +1235,7 @@ + unsigned int + ud_decode(struct ud *u) + { +- ud_inp_start(u); ++ inp_start(u); + clear_insn(u); + u->le = &ud_lookup_table_list[0]; + u->error = decode_prefixes(u) == -1 || +@@ -1114,7 +1246,7 @@ + /* clear out the decode data. */ + clear_insn(u); + /* mark the sequence of bytes as invalid. */ +- u->itab_entry = & s_ie__invalid; ++ u->itab_entry = &ud_itab[0]; /* entry 0 is invalid */ + u->mnemonic = u->itab_entry->mnemonic; + } + +@@ -1127,16 +1259,15 @@ + u->pfx_seg = 0; + + u->insn_offset = u->pc; /* set offset of instruction */ +- u->insn_fill = 0; /* set translation buffer index to 0 */ ++ u->asm_buf_fill = 0; /* set translation buffer index to 0 */ + u->pc += u->inp_ctr; /* move program counter by bytes decoded */ +- gen_hex( u ); /* generate hex code */ + + /* return number of bytes disassembled. */ + return u->inp_ctr; + } + ++#endif // USE(UDIS86) ++ + /* + vim: set ts=2 sw=2 expandtab + */ +- +-#endif // USE(UDIS86) +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_decode.h b/Source/JavaScriptCore/disassembler/udis86/udis86_decode.h +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_decode.h 2016-05-21 18:54:11.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_decode.h 2019-06-10 00:48:46.000000000 +0300 +@@ -27,74 +27,45 @@ + #define UD_DECODE_H + + #include "udis86_types.h" ++#include "udis86_udint.h" + #include "udis86_itab.h" + + #define MAX_INSN_LENGTH 15 + +-/* register classes */ +-#define T_NONE 0 +-#define T_GPR 1 +-#define T_MMX 2 +-#define T_CRG 3 +-#define T_DBG 4 +-#define T_SEG 5 +-#define T_XMM 6 +- + /* itab prefix bits */ + #define P_none ( 0 ) +-#define P_cast ( 1 << 0 ) +-#define P_CAST(n) ( ( n >> 0 ) & 1 ) +-#define P_c1 ( 1 << 0 ) +-#define P_C1(n) ( ( n >> 0 ) & 1 ) +-#define P_rexb ( 1 << 1 ) +-#define P_REXB(n) ( ( n >> 1 ) & 1 ) +-#define P_depM ( 1 << 2 ) +-#define P_DEPM(n) ( ( n >> 2 ) & 1 ) +-#define P_c3 ( 1 << 3 ) +-#define P_C3(n) ( ( n >> 3 ) & 1 ) +-#define P_inv64 ( 1 << 4 ) +-#define P_INV64(n) ( ( n >> 4 ) & 1 ) ++ ++#define P_inv64 ( 1 << 0 ) ++#define P_INV64(n) ( ( n >> 0 ) & 1 ) ++#define P_def64 ( 1 << 1 ) ++#define P_DEF64(n) ( ( n >> 1 ) & 1 ) ++ ++#define P_oso ( 1 << 2 ) ++#define P_OSO(n) ( ( n >> 2 ) & 1 ) ++#define P_aso ( 1 << 3 ) ++#define P_ASO(n) ( ( n >> 3 ) & 1 ) ++ ++#define P_rexb ( 1 << 4 ) ++#define P_REXB(n) ( ( n >> 4 ) & 1 ) + #define P_rexw ( 1 << 5 ) + #define P_REXW(n) ( ( n >> 5 ) & 1 ) +-#define P_c2 ( 1 << 6 ) +-#define P_C2(n) ( ( n >> 6 ) & 1 ) +-#define P_def64 ( 1 << 7 ) +-#define P_DEF64(n) ( ( n >> 7 ) & 1 ) +-#define P_rexr ( 1 << 8 ) +-#define P_REXR(n) ( ( n >> 8 ) & 1 ) +-#define P_oso ( 1 << 9 ) +-#define P_OSO(n) ( ( n >> 9 ) & 1 ) +-#define P_aso ( 1 << 10 ) +-#define P_ASO(n) ( ( n >> 10 ) & 1 ) +-#define P_rexx ( 1 << 11 ) +-#define P_REXX(n) ( ( n >> 11 ) & 1 ) +-#define P_ImpAddr ( 1 << 12 ) +-#define P_IMPADDR(n) ( ( n >> 12 ) & 1 ) +-#define P_seg ( 1 << 13 ) +-#define P_SEG(n) ( ( n >> 13 ) & 1 ) +-#define P_sext ( 1 << 14 ) +-#define P_SEXT(n) ( ( n >> 14 ) & 1 ) +- +-/* rex prefix bits */ +-#define REX_W(r) ( ( 0xF & ( r ) ) >> 3 ) +-#define REX_R(r) ( ( 0x7 & ( r ) ) >> 2 ) +-#define REX_X(r) ( ( 0x3 & ( r ) ) >> 1 ) +-#define REX_B(r) ( ( 0x1 & ( r ) ) >> 0 ) +-#define REX_PFX_MASK(n) ( ( P_REXW(n) << 3 ) | \ +- ( P_REXR(n) << 2 ) | \ +- ( P_REXX(n) << 1 ) | \ +- ( P_REXB(n) << 0 ) ) +- +-/* scable-index-base bits */ +-#define SIB_S(b) ( ( b ) >> 6 ) +-#define SIB_I(b) ( ( ( b ) >> 3 ) & 7 ) +-#define SIB_B(b) ( ( b ) & 7 ) +- +-/* modrm bits */ +-#define MODRM_REG(b) ( ( ( b ) >> 3 ) & 7 ) +-#define MODRM_NNN(b) ( ( ( b ) >> 3 ) & 7 ) +-#define MODRM_MOD(b) ( ( ( b ) >> 6 ) & 3 ) +-#define MODRM_RM(b) ( ( b ) & 7 ) ++#define P_rexr ( 1 << 6 ) ++#define P_REXR(n) ( ( n >> 6 ) & 1 ) ++#define P_rexx ( 1 << 7 ) ++#define P_REXX(n) ( ( n >> 7 ) & 1 ) ++ ++#define P_seg ( 1 << 8 ) ++#define P_SEG(n) ( ( n >> 8 ) & 1 ) ++ ++#define P_vexl ( 1 << 9 ) ++#define P_VEXL(n) ( ( n >> 9 ) & 1 ) ++#define P_vexw ( 1 << 10 ) ++#define P_VEXW(n) ( ( n >> 10 ) & 1 ) ++ ++#define P_str ( 1 << 11 ) ++#define P_STR(n) ( ( n >> 11 ) & 1 ) ++#define P_strz ( 1 << 12 ) ++#define P_STR_ZF(n) ( ( n >> 12 ) & 1 ) + + /* operand type constants -- order is important! */ + +@@ -102,25 +73,15 @@ + OP_NONE, + + OP_A, OP_E, OP_M, OP_G, +- OP_I, +- +- OP_AL, OP_CL, OP_DL, OP_BL, +- OP_AH, OP_CH, OP_DH, OP_BH, +- +- OP_ALr8b, OP_CLr9b, OP_DLr10b, OP_BLr11b, +- OP_AHr12b, OP_CHr13b, OP_DHr14b, OP_BHr15b, ++ OP_I, OP_F, + +- OP_AX, OP_CX, OP_DX, OP_BX, +- OP_SI, OP_DI, OP_SP, OP_BP, ++ OP_R0, OP_R1, OP_R2, OP_R3, ++ OP_R4, OP_R5, OP_R6, OP_R7, + +- OP_rAX, OP_rCX, OP_rDX, OP_rBX, +- OP_rSP, OP_rBP, OP_rSI, OP_rDI, +- +- OP_rAXr8, OP_rCXr9, OP_rDXr10, OP_rBXr11, +- OP_rSPr12, OP_rBPr13, OP_rSIr14, OP_rDIr15, +- +- OP_eAX, OP_eCX, OP_eDX, OP_eBX, +- OP_eSP, OP_eBP, OP_eSI, OP_eDI, ++ OP_AL, OP_CL, OP_DL, ++ OP_AX, OP_CX, OP_DX, ++ OP_eAX, OP_eCX, OP_eDX, ++ OP_rAX, OP_rCX, OP_rDX, + + OP_ES, OP_CS, OP_SS, OP_DS, + OP_FS, OP_GS, +@@ -129,45 +90,71 @@ + OP_ST4, OP_ST5, OP_ST6, OP_ST7, + + OP_J, OP_S, OP_O, +- OP_I1, OP_I3, ++ OP_I1, OP_I3, OP_sI, + + OP_V, OP_W, OP_Q, OP_P, ++ OP_U, OP_N, OP_MU, OP_H, ++ OP_L, + +- OP_R, OP_C, OP_D, OP_VR, OP_PR, ++ OP_R, OP_C, OP_D, + + OP_MR + } UD_ATTR_PACKED; + + +-/* operand size constants */ ++/* ++ * Operand size constants ++ * ++ * Symbolic constants for various operand sizes. Some of these constants ++ * are given a value equal to the width of the data (SZ_B == 8), such ++ * that they maybe used interchangeably in the internals. Modifying them ++ * will most certainly break things! ++ */ ++typedef uint16_t ud_operand_size_t; ++ ++#define SZ_NA 0 ++#define SZ_Z 1 ++#define SZ_V 2 ++#define SZ_Y 3 ++#define SZ_X 4 ++#define SZ_RDQ 7 ++#define SZ_B 8 ++#define SZ_W 16 ++#define SZ_D 32 ++#define SZ_Q 64 ++#define SZ_T 80 ++#define SZ_O 12 ++#define SZ_DQ 128 /* double quad */ ++#define SZ_QQ 256 /* quad quad */ ++ ++/* ++ * Complex size types; that encode sizes for operands of type MR (memory or ++ * register); for internal use only. Id space above 256. ++ */ ++#define SZ_BD ((SZ_B << 8) | SZ_D) ++#define SZ_BV ((SZ_B << 8) | SZ_V) ++#define SZ_WD ((SZ_W << 8) | SZ_D) ++#define SZ_WV ((SZ_W << 8) | SZ_V) ++#define SZ_WY ((SZ_W << 8) | SZ_Y) ++#define SZ_DY ((SZ_D << 8) | SZ_Y) ++#define SZ_WO ((SZ_W << 8) | SZ_O) ++#define SZ_DO ((SZ_D << 8) | SZ_O) ++#define SZ_QO ((SZ_Q << 8) | SZ_O) + +-enum ud_operand_size { +- SZ_NA = 0, +- SZ_Z = 1, +- SZ_V = 2, +- SZ_P = 3, +- SZ_WP = 4, +- SZ_DP = 5, +- SZ_MDQ = 6, +- SZ_RDQ = 7, +- +- /* the following values are used as is, +- * and thus hard-coded. changing them +- * will break internals +- */ +- SZ_B = 8, +- SZ_W = 16, +- SZ_D = 32, +- SZ_Q = 64, +- SZ_T = 80, +- SZ_O = 128, +- +- SZ_WV = 17, +- SZ_BV = 18, +- SZ_DY = 19 + +-} UD_ATTR_PACKED; ++/* resolve complex size type. ++ */ ++static UD_INLINE ud_operand_size_t ++Mx_mem_size(ud_operand_size_t size) ++{ ++ return (size >> 8) & 0xff; ++} + ++static UD_INLINE ud_operand_size_t ++Mx_reg_size(ud_operand_size_t size) ++{ ++ return size & 0xff; ++} + + /* A single operand of an entry in the instruction table. + * (internal use only) +@@ -175,7 +162,7 @@ + struct ud_itab_entry_operand + { + enum ud_operand_code type; +- enum ud_operand_size size; ++ ud_operand_size_t size; + }; + + +@@ -188,6 +175,7 @@ + struct ud_itab_entry_operand operand1; + struct ud_itab_entry_operand operand2; + struct ud_itab_entry_operand operand3; ++ struct ud_itab_entry_operand operand4; + uint32_t prefix; + }; + +@@ -197,55 +185,6 @@ + const char *meta; + }; + +- +-static inline unsigned int sse_pfx_idx( const unsigned int pfx ) +-{ +- /* 00 = 0 +- * f2 = 1 +- * f3 = 2 +- * 66 = 3 +- */ +- return ( ( pfx & 0xf ) + 1 ) / 2; +-} +- +-static inline unsigned int mode_idx( const unsigned int mode ) +-{ +- /* 16 = 0 +- * 32 = 1 +- * 64 = 2 +- */ +- return ( mode / 32 ); +-} +- +-static inline unsigned int modrm_mod_idx( const unsigned int mod ) +-{ +- /* !11 = 0 +- * 11 = 1 +- */ +- return ( mod + 1 ) / 4; +-} +- +-static inline unsigned int vendor_idx( const unsigned int vendor ) +-{ +- switch ( vendor ) { +- case UD_VENDOR_AMD: return 0; +- case UD_VENDOR_INTEL: return 1; +- case UD_VENDOR_ANY: return 2; +- default: return 2; +- } +-} +- +-static inline unsigned int is_group_ptr( uint16_t ptr ) +-{ +- return ( 0x8000 & ptr ); +-} +- +-static inline unsigned int group_idx( uint16_t ptr ) +-{ +- return ( ~0x8000 & ptr ); +-} +- +- + extern struct ud_itab_entry ud_itab[]; + extern struct ud_lookup_table_list_entry ud_lookup_table_list[]; + +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_extern.h b/Source/JavaScriptCore/disassembler/udis86/udis86_extern.h +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_extern.h 2016-05-21 18:54:11.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_extern.h 2019-06-10 00:48:46.000000000 +0300 +@@ -1,6 +1,6 @@ + /* udis86 - libudis86/extern.h + * +- * Copyright (c) 2002-2009 Vivek Thampi ++ * Copyright (c) 2002-2009, 2013 Vivek Thampi + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without modification, +@@ -32,57 +32,82 @@ + + #include "udis86_types.h" + ++#if defined(_MSC_VER) && defined(_USRDLL) ++# ifdef LIBUDIS86_EXPORTS ++# define LIBUDIS86_DLLEXTERN __declspec(dllexport) ++# else ++# define LIBUDIS86_DLLEXTERN __declspec(dllimport) ++# endif ++#else ++# define LIBUDIS86_DLLEXTERN ++#endif ++ + /* ============================= PUBLIC API ================================= */ + +-extern void ud_init(struct ud*); ++extern LIBUDIS86_DLLEXTERN void ud_init(struct ud*); + +-extern void ud_set_mode(struct ud*, uint8_t); ++extern LIBUDIS86_DLLEXTERN void ud_set_mode(struct ud*, uint8_t); + +-extern void ud_set_pc(struct ud*, uint64_t); ++extern LIBUDIS86_DLLEXTERN void ud_set_pc(struct ud*, uint64_t); + +-extern void ud_set_input_hook(struct ud*, int (*)(struct ud*)); ++extern LIBUDIS86_DLLEXTERN void ud_set_input_hook(struct ud*, int (*)(struct ud*)); + +-extern void ud_set_input_buffer(struct ud*, uint8_t*, size_t); ++extern LIBUDIS86_DLLEXTERN void ud_set_input_buffer(struct ud*, const uint8_t*, size_t); + + #ifndef __UD_STANDALONE__ +-extern void ud_set_input_file(struct ud*, FILE*); ++extern LIBUDIS86_DLLEXTERN void ud_set_input_file(struct ud*, FILE*); + #endif /* __UD_STANDALONE__ */ + +-extern void ud_set_vendor(struct ud*, unsigned); ++extern LIBUDIS86_DLLEXTERN void ud_set_vendor(struct ud*, unsigned); ++ ++extern LIBUDIS86_DLLEXTERN void ud_set_syntax(struct ud*, void (*)(struct ud*)); ++ ++extern LIBUDIS86_DLLEXTERN void ud_input_skip(struct ud*, size_t); ++ ++extern LIBUDIS86_DLLEXTERN int ud_input_end(const struct ud*); + +-extern void ud_set_syntax(struct ud*, void (*)(struct ud*)); ++extern LIBUDIS86_DLLEXTERN unsigned int ud_decode(struct ud*); + +-extern void ud_input_skip(struct ud*, size_t); ++extern LIBUDIS86_DLLEXTERN unsigned int ud_disassemble(struct ud*); + +-extern int ud_input_end(struct ud*); ++extern LIBUDIS86_DLLEXTERN void ud_translate_intel(struct ud*); + +-extern unsigned int ud_decode(struct ud*); ++extern LIBUDIS86_DLLEXTERN void ud_translate_att(struct ud*); + +-extern unsigned int ud_disassemble(struct ud*); ++extern LIBUDIS86_DLLEXTERN const char* ud_insn_asm(const struct ud* u); + +-extern void ud_translate_intel(struct ud*); ++extern LIBUDIS86_DLLEXTERN const uint8_t* ud_insn_ptr(const struct ud* u); + +-extern void ud_translate_att(struct ud*); ++extern LIBUDIS86_DLLEXTERN uint64_t ud_insn_off(const struct ud*); + +-extern char* ud_insn_asm(struct ud* u); ++extern LIBUDIS86_DLLEXTERN const char* ud_insn_hex(struct ud*); + +-extern uint8_t* ud_insn_ptr(struct ud* u); ++extern LIBUDIS86_DLLEXTERN unsigned int ud_insn_len(const struct ud* u); + +-extern uint64_t ud_insn_off(struct ud*); ++extern LIBUDIS86_DLLEXTERN const struct ud_operand* ud_insn_opr(const struct ud *u, unsigned int n); + +-extern char* ud_insn_hex(struct ud*); ++extern LIBUDIS86_DLLEXTERN int ud_opr_is_sreg(const struct ud_operand *opr); + +-extern unsigned int ud_insn_len(struct ud* u); ++extern LIBUDIS86_DLLEXTERN int ud_opr_is_gpr(const struct ud_operand *opr); + +-extern const char* ud_lookup_mnemonic(enum ud_mnemonic_code c); ++extern LIBUDIS86_DLLEXTERN enum ud_mnemonic_code ud_insn_mnemonic(const struct ud *u); + +-extern void ud_set_user_opaque_data(struct ud*, void*); ++extern LIBUDIS86_DLLEXTERN const char* ud_lookup_mnemonic(enum ud_mnemonic_code c); + +-extern void *ud_get_user_opaque_data(struct ud*); ++extern LIBUDIS86_DLLEXTERN void ud_set_user_opaque_data(struct ud*, void*); ++ ++extern LIBUDIS86_DLLEXTERN void* ud_get_user_opaque_data(const struct ud*); ++ ++extern LIBUDIS86_DLLEXTERN void ud_set_asm_buffer(struct ud *u, char *buf, size_t size); ++ ++extern LIBUDIS86_DLLEXTERN void ud_set_sym_resolver(struct ud *u, ++ const char* (*resolver)(struct ud*, ++ uint64_t addr, ++ int64_t *offset)); + + /* ========================================================================== */ + + #ifdef __cplusplus + } + #endif +-#endif ++#endif /* UD_EXTERN_H */ +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_input.c b/Source/JavaScriptCore/disassembler/udis86/udis86_input.c +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_input.c 2016-05-21 18:54:11.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_input.c 1970-01-01 02:00:00.000000000 +0200 +@@ -1,262 +0,0 @@ +-/* udis86 - libudis86/input.c +- * +- * Copyright (c) 2002-2009 Vivek Thampi +- * All rights reserved. +- * +- * Redistribution and use in source and binary forms, with or without modification, +- * are permitted provided that the following conditions are met: +- * +- * * Redistributions of source code must retain the above copyright notice, +- * this list of conditions and the following disclaimer. +- * * Redistributions in binary form must reproduce the above copyright notice, +- * this list of conditions and the following disclaimer in the documentation +- * and/or other materials provided with the distribution. +- * +- * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND +- * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED +- * WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE +- * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR +- * ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES +- * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; +- * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON +- * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +- * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS +- * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +- */ +-#include "config.h" +- +-#if USE(UDIS86) +- +-#include "udis86_extern.h" +-#include "udis86_types.h" +-#include "udis86_input.h" +- +-/* ----------------------------------------------------------------------------- +- * inp_buff_hook() - Hook for buffered inputs. +- * ----------------------------------------------------------------------------- +- */ +-static int +-inp_buff_hook(struct ud* u) +-{ +- if (u->inp_buff < u->inp_buff_end) +- return *u->inp_buff++; +- else return -1; +-} +- +-#ifndef __UD_STANDALONE__ +-/* ----------------------------------------------------------------------------- +- * inp_file_hook() - Hook for FILE inputs. +- * ----------------------------------------------------------------------------- +- */ +-static int +-inp_file_hook(struct ud* u) +-{ +- return fgetc(u->inp_file); +-} +-#endif /* __UD_STANDALONE__*/ +- +-/* ============================================================================= +- * ud_inp_set_hook() - Sets input hook. +- * ============================================================================= +- */ +-extern void +-ud_set_input_hook(register struct ud* u, int (*hook)(struct ud*)) +-{ +- u->inp_hook = hook; +- ud_inp_init(u); +-} +- +-extern void +-ud_set_user_opaque_data( struct ud * u, void * opaque ) +-{ +- u->user_opaque_data = opaque; +-} +- +-extern void * +-ud_get_user_opaque_data( struct ud * u ) +-{ +- return u->user_opaque_data; +-} +- +-/* ============================================================================= +- * ud_inp_set_buffer() - Set buffer as input. +- * ============================================================================= +- */ +-extern void +-ud_set_input_buffer(register struct ud* u, uint8_t* buf, size_t len) +-{ +- u->inp_hook = inp_buff_hook; +- u->inp_buff = buf; +- u->inp_buff_end = buf + len; +- ud_inp_init(u); +-} +- +-#ifndef __UD_STANDALONE__ +-/* ============================================================================= +- * ud_input_set_file() - Set buffer as input. +- * ============================================================================= +- */ +-extern void +-ud_set_input_file(register struct ud* u, FILE* f) +-{ +- u->inp_hook = inp_file_hook; +- u->inp_file = f; +- ud_inp_init(u); +-} +-#endif /* __UD_STANDALONE__ */ +- +-/* ============================================================================= +- * ud_input_skip() - Skip n input bytes. +- * ============================================================================= +- */ +-extern void +-ud_input_skip(struct ud* u, size_t n) +-{ +- while (n--) { +- u->inp_hook(u); +- } +-} +- +-/* ============================================================================= +- * ud_input_end() - Test for end of input. +- * ============================================================================= +- */ +-extern int +-ud_input_end(struct ud* u) +-{ +- return (u->inp_curr == u->inp_fill) && u->inp_end; +-} +- +-/* ----------------------------------------------------------------------------- +- * ud_inp_next() - Loads and returns the next byte from input. +- * +- * inp_curr and inp_fill are pointers to the cache. The program is written based +- * on the property that they are 8-bits in size, and will eventually wrap around +- * forming a circular buffer. So, the size of the cache is 256 in size, kind of +- * unnecessary yet optimized. +- * +- * A buffer inp_sess stores the bytes disassembled for a single session. +- * ----------------------------------------------------------------------------- +- */ +-extern uint8_t ud_inp_next(struct ud* u) +-{ +- int c = -1; +- /* if current pointer is not upto the fill point in the +- * input cache. +- */ +- if ( u->inp_curr != u->inp_fill ) { +- c = u->inp_cache[ ++u->inp_curr ]; +- /* if !end-of-input, call the input hook and get a byte */ +- } else if ( u->inp_end || ( c = u->inp_hook( u ) ) == -1 ) { +- /* end-of-input, mark it as an error, since the decoder, +- * expected a byte more. +- */ +- u->error = 1; +- /* flag end of input */ +- u->inp_end = 1; +- return 0; +- } else { +- /* increment pointers, we have a new byte. */ +- u->inp_curr = ++u->inp_fill; +- /* add the byte to the cache */ +- u->inp_cache[ u->inp_fill ] = c; +- } +- /* record bytes input per decode-session. */ +- u->inp_sess[ u->inp_ctr++ ] = c; +- /* return byte */ +- return ( uint8_t ) c; +-} +- +-/* ----------------------------------------------------------------------------- +- * ud_inp_back() - Move back a single byte in the stream. +- * ----------------------------------------------------------------------------- +- */ +-extern void +-ud_inp_back(struct ud* u) +-{ +- if ( u->inp_ctr > 0 ) { +- --u->inp_curr; +- --u->inp_ctr; +- } +-} +- +-/* ----------------------------------------------------------------------------- +- * ud_inp_peek() - Peek into the next byte in source. +- * ----------------------------------------------------------------------------- +- */ +-extern uint8_t +-ud_inp_peek(struct ud* u) +-{ +- uint8_t r = ud_inp_next(u); +- if ( !u->error ) ud_inp_back(u); /* Don't backup if there was an error */ +- return r; +-} +- +-/* ----------------------------------------------------------------------------- +- * ud_inp_move() - Move ahead n input bytes. +- * ----------------------------------------------------------------------------- +- */ +-extern void +-ud_inp_move(struct ud* u, size_t n) +-{ +- while (n--) +- ud_inp_next(u); +-} +- +-/*------------------------------------------------------------------------------ +- * ud_inp_uintN() - return uintN from source. +- *------------------------------------------------------------------------------ +- */ +-extern uint8_t +-ud_inp_uint8(struct ud* u) +-{ +- return ud_inp_next(u); +-} +- +-extern uint16_t +-ud_inp_uint16(struct ud* u) +-{ +- uint16_t r, ret; +- +- ret = ud_inp_next(u); +- r = ud_inp_next(u); +- return ret | (r << 8); +-} +- +-extern uint32_t +-ud_inp_uint32(struct ud* u) +-{ +- uint32_t r, ret; +- +- ret = ud_inp_next(u); +- r = ud_inp_next(u); +- ret = ret | (r << 8); +- r = ud_inp_next(u); +- ret = ret | (r << 16); +- r = ud_inp_next(u); +- return ret | (r << 24); +-} +- +-extern uint64_t +-ud_inp_uint64(struct ud* u) +-{ +- uint64_t r, ret; +- +- ret = ud_inp_next(u); +- r = ud_inp_next(u); +- ret = ret | (r << 8); +- r = ud_inp_next(u); +- ret = ret | (r << 16); +- r = ud_inp_next(u); +- ret = ret | (r << 24); +- r = ud_inp_next(u); +- ret = ret | (r << 32); +- r = ud_inp_next(u); +- ret = ret | (r << 40); +- r = ud_inp_next(u); +- ret = ret | (r << 48); +- r = ud_inp_next(u); +- return ret | (r << 56); +-} +- +-#endif // USE(UDIS86) +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_input.h b/Source/JavaScriptCore/disassembler/udis86/udis86_input.h +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_input.h 2016-05-21 18:54:11.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_input.h 1970-01-01 02:00:00.000000000 +0200 +@@ -1,67 +0,0 @@ +-/* udis86 - libudis86/input.h +- * +- * Copyright (c) 2002-2009 Vivek Thampi +- * All rights reserved. +- * +- * Redistribution and use in source and binary forms, with or without modification, +- * are permitted provided that the following conditions are met: +- * +- * * Redistributions of source code must retain the above copyright notice, +- * this list of conditions and the following disclaimer. +- * * Redistributions in binary form must reproduce the above copyright notice, +- * this list of conditions and the following disclaimer in the documentation +- * and/or other materials provided with the distribution. +- * +- * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND +- * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED +- * WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE +- * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR +- * ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES +- * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; +- * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON +- * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +- * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS +- * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +- */ +-#ifndef UD_INPUT_H +-#define UD_INPUT_H +- +-#include "udis86_types.h" +- +-uint8_t ud_inp_next(struct ud*); +-uint8_t ud_inp_peek(struct ud*); +-uint8_t ud_inp_uint8(struct ud*); +-uint16_t ud_inp_uint16(struct ud*); +-uint32_t ud_inp_uint32(struct ud*); +-uint64_t ud_inp_uint64(struct ud*); +-void ud_inp_move(struct ud*, size_t); +-void ud_inp_back(struct ud*); +- +-/* ud_inp_init() - Initializes the input system. */ +-#define ud_inp_init(u) \ +-do { \ +- u->inp_curr = 0; \ +- u->inp_fill = 0; \ +- u->inp_ctr = 0; \ +- u->inp_end = 0; \ +-} while (0) +- +-/* ud_inp_start() - Should be called before each de-code operation. */ +-#define ud_inp_start(u) u->inp_ctr = 0 +- +-/* ud_inp_back() - Resets the current pointer to its position before the current +- * instruction disassembly was started. +- */ +-#define ud_inp_reset(u) \ +-do { \ +- u->inp_curr -= u->inp_ctr; \ +- u->inp_ctr = 0; \ +-} while (0) +- +-/* ud_inp_sess() - Returns the pointer to current session. */ +-#define ud_inp_sess(u) (u->inp_sess) +- +-/* inp_cur() - Returns the current input byte. */ +-#define ud_inp_curr(u) ((u)->inp_cache[(u)->inp_curr]) +- +-#endif +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_syn-att.c b/Source/JavaScriptCore/disassembler/udis86/udis86_syn-att.c +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_syn-att.c 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_syn-att.c 2019-06-10 00:48:46.000000000 +0300 +@@ -23,6 +23,7 @@ + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS + * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ ++ + #include "config.h" + + #if USE(UDIS86) +@@ -32,6 +33,7 @@ + #include "udis86_decode.h" + #include "udis86_itab.h" + #include "udis86_syn.h" ++#include "udis86_udint.h" + + /* ----------------------------------------------------------------------------- + * opr_cast() - Prints an operand cast. +@@ -41,9 +43,9 @@ + opr_cast(struct ud* u, struct ud_operand* op) + { + switch(op->size) { +- case 16 : case 32 : +- mkasm(u, "*"); break; +- default: break; ++ case 16 : case 32 : ++ ud_asmprintf(u, "*"); break; ++ default: break; + } + } + +@@ -55,107 +57,66 @@ + gen_operand(struct ud* u, struct ud_operand* op) + { + switch(op->type) { +- case UD_OP_REG: +- mkasm(u, "%%%s", ud_reg_tab[op->base - UD_R_AL]); +- break; +- +- case UD_OP_MEM: +- if (u->br_far) opr_cast(u, op); +- if (u->pfx_seg) +- mkasm(u, "%%%s:", ud_reg_tab[u->pfx_seg - UD_R_AL]); +- if (op->offset == 8) { +- if (op->lval.sbyte < 0) +- mkasm(u, "-0x%x", (-op->lval.sbyte) & 0xff); +- else +- mkasm(u, "0x%x", op->lval.sbyte); +- } +- else if (op->offset == 16) { +- if (op->lval.sword < 0) +- mkasm(u, "-0x%x", (-op->lval.sword) & 0xffff); +- else +- mkasm(u, "0x%x", op->lval.sword); +- } else if (op->offset == 32) { +- if (op->lval.sdword < 0) +- mkasm(u, "-0x%x", (-op->lval.sdword) & 0xffffffff); +- else +- mkasm(u, "0x%x", op->lval.sdword); +- } else if (op->offset == 64) { +- if (op->lval.sdword < 0) +- mkasm(u, "-0x" FMT64 "x", (uint64_t)-op->lval.sqword); +- else +- mkasm(u, "0x" FMT64 "x", (uint64_t)op->lval.sqword); +- } +- +- if (op->base) +- mkasm(u, "(%%%s", ud_reg_tab[op->base - UD_R_AL]); +- if (op->index) { +- if (op->base) +- mkasm(u, ","); +- else mkasm(u, "("); +- mkasm(u, "%%%s", ud_reg_tab[op->index - UD_R_AL]); +- } +- if (op->scale) +- mkasm(u, ",%d", op->scale); +- if (op->base || op->index) +- mkasm(u, ")"); +- break; +- +- case UD_OP_IMM: { +- int64_t imm = 0; +- uint64_t sext_mask = 0xffffffffffffffffull; +- unsigned sext_size = op->size; +- +- switch (op->size) { +- case 8: imm = op->lval.sbyte; break; +- case 16: imm = op->lval.sword; break; +- case 32: imm = op->lval.sdword; break; +- case 64: imm = op->lval.sqword; break; +- } +- if ( P_SEXT( u->itab_entry->prefix ) ) { +- sext_size = u->operand[ 0 ].size; +- if ( u->mnemonic == UD_Ipush ) +- /* push sign-extends to operand size */ +- sext_size = u->opr_mode; +- } +- if ( sext_size < 64 ) +- sext_mask = ( 1ull << sext_size ) - 1; +- mkasm( u, "$0x" FMT64 "x", (uint64_t)(imm & sext_mask) ); +- +- break; +- } +- +- case UD_OP_JIMM: +- switch (op->size) { +- case 8: +- mkasm(u, "0x" FMT64 "x", (uint64_t)(u->pc + op->lval.sbyte)); +- break; +- case 16: +- mkasm(u, "0x" FMT64 "x", (uint64_t)((u->pc + op->lval.sword) & 0xffff) ); +- break; +- case 32: +- if (u->dis_mode == 32) +- mkasm(u, "0x" FMT64 "x", (uint64_t)((u->pc + op->lval.sdword) & 0xffffffff)); +- else +- mkasm(u, "0x" FMT64 "x", (uint64_t)(u->pc + op->lval.sdword)); +- break; +- default:break; +- } +- break; +- +- case UD_OP_PTR: +- switch (op->size) { +- case 32: +- mkasm(u, "$0x%x, $0x%x", op->lval.ptr.seg, +- op->lval.ptr.off & 0xFFFF); +- break; +- case 48: +- mkasm(u, "$0x%x, $0x%lx", op->lval.ptr.seg, +- (unsigned long)op->lval.ptr.off); +- break; +- } +- break; +- +- default: return; ++ case UD_OP_CONST: ++ ud_asmprintf(u, "$0x%x", op->lval.udword); ++ break; ++ ++ case UD_OP_REG: ++ ud_asmprintf(u, "%%%s", ud_reg_tab[op->base - UD_R_AL]); ++ break; ++ ++ case UD_OP_MEM: ++ if (u->br_far) { ++ opr_cast(u, op); ++ } ++ if (u->pfx_seg) { ++ ud_asmprintf(u, "%%%s:", ud_reg_tab[u->pfx_seg - UD_R_AL]); ++ } ++ if (op->offset != 0) { ++ ud_syn_print_mem_disp(u, op, 0); ++ } ++ if (op->base) { ++ ud_asmprintf(u, "(%%%s", ud_reg_tab[op->base - UD_R_AL]); ++ } ++ if (op->index) { ++ if (op->base) { ++ ud_asmprintf(u, ","); ++ } else { ++ ud_asmprintf(u, "("); ++ } ++ ud_asmprintf(u, "%%%s", ud_reg_tab[op->index - UD_R_AL]); ++ } ++ if (op->scale) { ++ ud_asmprintf(u, ",%d", op->scale); ++ } ++ if (op->base || op->index) { ++ ud_asmprintf(u, ")"); ++ } ++ break; ++ ++ case UD_OP_IMM: ++ ud_asmprintf(u, "$"); ++ ud_syn_print_imm(u, op); ++ break; ++ ++ case UD_OP_JIMM: ++ ud_syn_print_addr(u, ud_syn_rel_target(u, op)); ++ break; ++ ++ case UD_OP_PTR: ++ switch (op->size) { ++ case 32: ++ ud_asmprintf(u, "$0x%x, $0x%x", op->lval.ptr.seg, ++ op->lval.ptr.off & 0xFFFF); ++ break; ++ case 48: ++ ud_asmprintf(u, "$0x%x, $0x%x", op->lval.ptr.seg, ++ op->lval.ptr.off); ++ break; ++ } ++ break; ++ ++ default: return; + } + } + +@@ -167,99 +128,108 @@ + ud_translate_att(struct ud *u) + { + int size = 0; +- unsigned i; ++ int star = 0; + + /* check if P_OSO prefix is used */ + if (! P_OSO(u->itab_entry->prefix) && u->pfx_opr) { +- switch (u->dis_mode) { +- case 16: +- mkasm(u, "o32 "); +- break; +- case 32: +- case 64: +- mkasm(u, "o16 "); +- break; +- } ++ switch (u->dis_mode) { ++ case 16: ++ ud_asmprintf(u, "o32 "); ++ break; ++ case 32: ++ case 64: ++ ud_asmprintf(u, "o16 "); ++ break; ++ } + } + + /* check if P_ASO prefix was used */ + if (! P_ASO(u->itab_entry->prefix) && u->pfx_adr) { +- switch (u->dis_mode) { +- case 16: +- mkasm(u, "a32 "); +- break; +- case 32: +- mkasm(u, "a16 "); +- break; +- case 64: +- mkasm(u, "a32 "); +- break; +- } ++ switch (u->dis_mode) { ++ case 16: ++ ud_asmprintf(u, "a32 "); ++ break; ++ case 32: ++ ud_asmprintf(u, "a16 "); ++ break; ++ case 64: ++ ud_asmprintf(u, "a32 "); ++ break; ++ } + } + + if (u->pfx_lock) +- mkasm(u, "lock "); +- if (u->pfx_rep) +- mkasm(u, "rep "); +- if (u->pfx_repne) +- mkasm(u, "repne "); ++ ud_asmprintf(u, "lock "); ++ if (u->pfx_rep) { ++ ud_asmprintf(u, "rep "); ++ } else if (u->pfx_repe) { ++ ud_asmprintf(u, "repe "); ++ } else if (u->pfx_repne) { ++ ud_asmprintf(u, "repne "); ++ } + + /* special instructions */ + switch (u->mnemonic) { +- case UD_Iretf: +- mkasm(u, "lret "); +- break; +- case UD_Idb: +- mkasm(u, ".byte 0x%x", u->operand[0].lval.ubyte); +- return; +- case UD_Ijmp: +- case UD_Icall: +- if (u->br_far) mkasm(u, "l"); +- mkasm(u, "%s", ud_lookup_mnemonic(u->mnemonic)); +- break; +- case UD_Ibound: +- case UD_Ienter: +- if (u->operand[0].type != UD_NONE) +- gen_operand(u, &u->operand[0]); +- if (u->operand[1].type != UD_NONE) { +- mkasm(u, ","); +- gen_operand(u, &u->operand[1]); +- } +- return; +- default: +- mkasm(u, "%s", ud_lookup_mnemonic(u->mnemonic)); +- } +- +- for (i = 3; i--;) { +- if (u->operand[i].size > size +- && u->operand[i].type != UD_OP_JIMM) +- size = u->operand[i].size; +- } +- +- if (size == 8) +- mkasm(u, "b"); +- else if (size == 16) +- mkasm(u, "w"); +- else if (size == 32) +- mkasm(u, "l"); +- else if (size == 64) +- mkasm(u, "q"); ++ case UD_Iretf: ++ ud_asmprintf(u, "lret "); ++ break; ++ case UD_Idb: ++ ud_asmprintf(u, ".byte 0x%x", u->operand[0].lval.ubyte); ++ return; ++ case UD_Ijmp: ++ case UD_Icall: ++ if (u->br_far) ud_asmprintf(u, "l"); ++ if (u->operand[0].type == UD_OP_REG) { ++ star = 1; ++ } ++ ud_asmprintf(u, "%s", ud_lookup_mnemonic(u->mnemonic)); ++ break; ++ case UD_Ibound: ++ case UD_Ienter: ++ if (u->operand[0].type != UD_NONE) ++ gen_operand(u, &u->operand[0]); ++ if (u->operand[1].type != UD_NONE) { ++ ud_asmprintf(u, ","); ++ gen_operand(u, &u->operand[1]); ++ } ++ return; ++ default: ++ ud_asmprintf(u, "%s", ud_lookup_mnemonic(u->mnemonic)); ++ } ++ ++ if (size == 8) { ++ ud_asmprintf(u, "b"); ++ } else if (size == 16) { ++ ud_asmprintf(u, "w"); ++ } else if (size == 64) { ++ ud_asmprintf(u, "q"); ++ } + +- mkasm(u, " "); ++ if (star) { ++ ud_asmprintf(u, " *"); ++ } else { ++ ud_asmprintf(u, " "); ++ } + ++ if (u->operand[3].type != UD_NONE) { ++ gen_operand(u, &u->operand[3]); ++ ud_asmprintf(u, ", "); ++ } + if (u->operand[2].type != UD_NONE) { +- gen_operand(u, &u->operand[2]); +- mkasm(u, ", "); ++ gen_operand(u, &u->operand[2]); ++ ud_asmprintf(u, ", "); + } +- + if (u->operand[1].type != UD_NONE) { +- gen_operand(u, &u->operand[1]); +- mkasm(u, ", "); ++ gen_operand(u, &u->operand[1]); ++ ud_asmprintf(u, ", "); ++ } ++ if (u->operand[0].type != UD_NONE) { ++ gen_operand(u, &u->operand[0]); + } +- +- if (u->operand[0].type != UD_NONE) +- gen_operand(u, &u->operand[0]); + } + + #endif // USE(UDIS86) + ++/* ++vim: set ts=2 sw=2 expandtab ++*/ +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_syn.c b/Source/JavaScriptCore/disassembler/udis86/udis86_syn.c +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_syn.c 2016-05-21 18:54:11.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_syn.c 2019-06-10 00:48:46.000000000 +0300 +@@ -1,6 +1,6 @@ + /* udis86 - libudis86/syn.c + * +- * Copyright (c) 2002-2009 Vivek Thampi ++ * Copyright (c) 2002-2013 Vivek Thampi + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without modification, +@@ -28,59 +28,192 @@ + + #if USE(UDIS86) + +-/* ----------------------------------------------------------------------------- +- * Intel Register Table - Order Matters (types.h)! +- * ----------------------------------------------------------------------------- ++#include "udis86_types.h" ++#include "udis86_decode.h" ++#include "udis86_syn.h" ++#include "udis86_udint.h" ++ ++/* ++ * Register Table - Order Matters (types.h)! ++ * + */ + const char* ud_reg_tab[] = + { +- "al", "cl", "dl", "bl", +- "ah", "ch", "dh", "bh", +- "spl", "bpl", "sil", "dil", +- "r8b", "r9b", "r10b", "r11b", +- "r12b", "r13b", "r14b", "r15b", +- +- "ax", "cx", "dx", "bx", +- "sp", "bp", "si", "di", +- "r8w", "r9w", "r10w", "r11w", +- "r12w", "r13W" , "r14w", "r15w", +- +- "eax", "ecx", "edx", "ebx", +- "esp", "ebp", "esi", "edi", +- "r8d", "r9d", "r10d", "r11d", +- "r12d", "r13d", "r14d", "r15d", +- +- "rax", "rcx", "rdx", "rbx", +- "rsp", "rbp", "rsi", "rdi", +- "r8", "r9", "r10", "r11", +- "r12", "r13", "r14", "r15", +- +- "es", "cs", "ss", "ds", +- "fs", "gs", +- +- "cr0", "cr1", "cr2", "cr3", +- "cr4", "cr5", "cr6", "cr7", +- "cr8", "cr9", "cr10", "cr11", +- "cr12", "cr13", "cr14", "cr15", +- +- "dr0", "dr1", "dr2", "dr3", +- "dr4", "dr5", "dr6", "dr7", +- "dr8", "dr9", "dr10", "dr11", +- "dr12", "dr13", "dr14", "dr15", +- +- "mm0", "mm1", "mm2", "mm3", +- "mm4", "mm5", "mm6", "mm7", +- +- "st0", "st1", "st2", "st3", +- "st4", "st5", "st6", "st7", +- +- "xmm0", "xmm1", "xmm2", "xmm3", +- "xmm4", "xmm5", "xmm6", "xmm7", +- "xmm8", "xmm9", "xmm10", "xmm11", +- "xmm12", "xmm13", "xmm14", "xmm15", ++ "al", "cl", "dl", "bl", ++ "ah", "ch", "dh", "bh", ++ "spl", "bpl", "sil", "dil", ++ "r8b", "r9b", "r10b", "r11b", ++ "r12b", "r13b", "r14b", "r15b", ++ ++ "ax", "cx", "dx", "bx", ++ "sp", "bp", "si", "di", ++ "r8w", "r9w", "r10w", "r11w", ++ "r12w", "r13w", "r14w", "r15w", ++ ++ "eax", "ecx", "edx", "ebx", ++ "esp", "ebp", "esi", "edi", ++ "r8d", "r9d", "r10d", "r11d", ++ "r12d", "r13d", "r14d", "r15d", ++ ++ "rax", "rcx", "rdx", "rbx", ++ "rsp", "rbp", "rsi", "rdi", ++ "r8", "r9", "r10", "r11", ++ "r12", "r13", "r14", "r15", ++ ++ "es", "cs", "ss", "ds", ++ "fs", "gs", ++ ++ "cr0", "cr1", "cr2", "cr3", ++ "cr4", "cr5", "cr6", "cr7", ++ "cr8", "cr9", "cr10", "cr11", ++ "cr12", "cr13", "cr14", "cr15", ++ ++ "dr0", "dr1", "dr2", "dr3", ++ "dr4", "dr5", "dr6", "dr7", ++ "dr8", "dr9", "dr10", "dr11", ++ "dr12", "dr13", "dr14", "dr15", ++ ++ "mm0", "mm1", "mm2", "mm3", ++ "mm4", "mm5", "mm6", "mm7", ++ ++ "st0", "st1", "st2", "st3", ++ "st4", "st5", "st6", "st7", ++ ++ "xmm0", "xmm1", "xmm2", "xmm3", ++ "xmm4", "xmm5", "xmm6", "xmm7", ++ "xmm8", "xmm9", "xmm10", "xmm11", ++ "xmm12", "xmm13", "xmm14", "xmm15", ++ ++ "ymm0", "ymm1", "ymm2", "ymm3", ++ "ymm4", "ymm5", "ymm6", "ymm7", ++ "ymm8", "ymm9", "ymm10", "ymm11", ++ "ymm12", "ymm13", "ymm14", "ymm15", + + "rip" + }; + ++ ++uint64_t ++ud_syn_rel_target(struct ud *u, struct ud_operand *opr) ++{ ++ const uint64_t trunc_mask = 0xffffffffffffffffull >> (64 - u->opr_mode); ++ switch (opr->size) { ++ case 8 : return (u->pc + opr->lval.sbyte) & trunc_mask; ++ case 16: return (u->pc + opr->lval.sword) & trunc_mask; ++ case 32: return (u->pc + opr->lval.sdword) & trunc_mask; ++ default: UD_ASSERT(!"invalid relative offset size."); ++ return 0ull; ++ } ++} ++ ++ ++/* ++ * asmprintf ++ * Printf style function for printing translated assembly ++ * output. Returns the number of characters written and ++ * moves the buffer pointer forward. On an overflow, ++ * returns a negative number and truncates the output. ++ */ ++int ++ud_asmprintf(struct ud *u, const char *fmt, ...) ++{ ++ int ret; ++ int avail; ++ va_list ap; ++ va_start(ap, fmt); ++ avail = u->asm_buf_size - u->asm_buf_fill - 1 /* nullchar */; ++ ret = vsnprintf((char*) u->asm_buf + u->asm_buf_fill, avail, fmt, ap); ++ if (ret < 0 || ret > avail) { ++ u->asm_buf_fill = u->asm_buf_size - 1; ++ } else { ++ u->asm_buf_fill += ret; ++ } ++ va_end(ap); ++ return ret; ++} ++ ++ ++void ++ud_syn_print_addr(struct ud *u, uint64_t addr) ++{ ++ const char *name = NULL; ++ if (u->sym_resolver) { ++ int64_t offset = 0; ++ name = u->sym_resolver(u, addr, &offset); ++ if (name) { ++ if (offset) { ++ ud_asmprintf(u, "%s%+" FMT64 "d", name, offset); ++ } else { ++ ud_asmprintf(u, "%s", name); ++ } ++ return; ++ } ++ } ++ ud_asmprintf(u, "0x%" FMT64 "x", addr); ++} ++ ++ ++void ++ud_syn_print_imm(struct ud* u, const struct ud_operand *op) ++{ ++ uint64_t v; ++ if (op->_oprcode == OP_sI && op->size != u->opr_mode) { ++ if (op->size == 8) { ++ v = (int64_t)op->lval.sbyte; ++ } else { ++ UD_ASSERT(op->size == 32); ++ v = (int64_t)op->lval.sdword; ++ } ++ if (u->opr_mode < 64) { ++ v = v & ((1ull << u->opr_mode) - 1ull); ++ } ++ } else { ++ switch (op->size) { ++ case 8 : v = op->lval.ubyte; break; ++ case 16: v = op->lval.uword; break; ++ case 32: v = op->lval.udword; break; ++ case 64: v = op->lval.uqword; break; ++ default: UD_ASSERT(!"invalid offset"); v = 0; /* keep cc happy */ ++ } ++ } ++ ud_asmprintf(u, "0x%" FMT64 "x", v); ++} ++ ++ ++void ++ud_syn_print_mem_disp(struct ud* u, const struct ud_operand *op, int sign) ++{ ++ UD_ASSERT(op->offset != 0); ++ if (op->base == UD_NONE && op->index == UD_NONE) { ++ uint64_t v; ++ UD_ASSERT(op->scale == UD_NONE && op->offset != 8); ++ /* unsigned mem-offset */ ++ switch (op->offset) { ++ case 16: v = op->lval.uword; break; ++ case 32: v = op->lval.udword; break; ++ case 64: v = op->lval.uqword; break; ++ default: UD_ASSERT(!"invalid offset"); v = 0; /* keep cc happy */ ++ } ++ ud_asmprintf(u, "0x%" FMT64 "x", v); ++ } else { ++ int64_t v; ++ UD_ASSERT(op->offset != 64); ++ switch (op->offset) { ++ case 8 : v = op->lval.sbyte; break; ++ case 16: v = op->lval.sword; break; ++ case 32: v = op->lval.sdword; break; ++ default: UD_ASSERT(!"invalid offset"); v = 0; /* keep cc happy */ ++ } ++ if (v < 0) { ++ ud_asmprintf(u, "-0x%" FMT64 "x", -v); ++ } else if (v > 0) { ++ ud_asmprintf(u, "%s0x%" FMT64 "x", sign? "+" : "", v); ++ } ++ } ++} ++ + #endif // USE(UDIS86) + ++/* ++vim: set ts=2 sw=2 expandtab ++*/ +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_syn.h b/Source/JavaScriptCore/disassembler/udis86/udis86_syn.h +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_syn.h 2016-05-21 18:54:11.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_syn.h 2019-06-10 00:48:46.000000000 +0300 +@@ -27,21 +27,27 @@ + #define UD_SYN_H + + #include "udis86_types.h" +-#include +- + #ifndef __UD_STANDALONE__ + # include + #endif /* __UD_STANDALONE__ */ + + extern const char* ud_reg_tab[]; + +-static void mkasm(struct ud* u, const char* fmt, ...) WTF_ATTRIBUTE_PRINTF(2, 3); +-static void mkasm(struct ud* u, const char* fmt, ...) +-{ +- va_list ap; +- va_start(ap, fmt); +- u->insn_fill += vsnprintf((char*) u->insn_buffer + u->insn_fill, UD_STRING_BUFFER_SIZE - u->insn_fill, fmt, ap); +- va_end(ap); +-} ++uint64_t ud_syn_rel_target(struct ud*, struct ud_operand*); + ++#ifdef __GNUC__ ++int ud_asmprintf(struct ud *u, const char *fmt, ...) ++ __attribute__ ((format (printf, 2, 3))); ++#else ++int ud_asmprintf(struct ud *u, const char *fmt, ...); + #endif ++ ++void ud_syn_print_addr(struct ud *u, uint64_t addr); ++void ud_syn_print_imm(struct ud* u, const struct ud_operand *op); ++void ud_syn_print_mem_disp(struct ud* u, const struct ud_operand *, int sign); ++ ++#endif /* UD_SYN_H */ ++ ++/* ++vim: set ts=2 sw=2 expandtab ++*/ +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_syn-intel.c b/Source/JavaScriptCore/disassembler/udis86/udis86_syn-intel.c +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_syn-intel.c 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_syn-intel.c 2019-06-10 00:48:46.000000000 +0300 +@@ -1,6 +1,6 @@ + /* udis86 - libudis86/syn-intel.c + * +- * Copyright (c) 2002-2009 Vivek Thampi ++ * Copyright (c) 2002-2013 Vivek Thampi + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without modification, +@@ -23,6 +23,7 @@ + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS + * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ ++ + #include "config.h" + + #if USE(UDIS86) +@@ -32,6 +33,7 @@ + #include "udis86_decode.h" + #include "udis86_itab.h" + #include "udis86_syn.h" ++#include "udis86_udint.h" + + /* ----------------------------------------------------------------------------- + * opr_cast() - Prints an operand cast. +@@ -40,16 +42,19 @@ + static void + opr_cast(struct ud* u, struct ud_operand* op) + { ++ if (u->br_far) { ++ ud_asmprintf(u, "far "); ++ } + switch(op->size) { +- case 8: mkasm(u, "byte " ); break; +- case 16: mkasm(u, "word " ); break; +- case 32: mkasm(u, "dword "); break; +- case 64: mkasm(u, "qword "); break; +- case 80: mkasm(u, "tword "); break; +- default: break; ++ case 8: ud_asmprintf(u, "byte " ); break; ++ case 16: ud_asmprintf(u, "word " ); break; ++ case 32: ud_asmprintf(u, "dword "); break; ++ case 64: ud_asmprintf(u, "qword "); break; ++ case 80: ud_asmprintf(u, "tword "); break; ++ case 128: ud_asmprintf(u, "oword "); break; ++ case 256: ud_asmprintf(u, "yword "); break; ++ default: break; + } +- if (u->br_far) +- mkasm(u, "far "); + } + + /* ----------------------------------------------------------------------------- +@@ -59,121 +64,63 @@ + static void gen_operand(struct ud* u, struct ud_operand* op, int syn_cast) + { + switch(op->type) { +- case UD_OP_REG: +- mkasm(u, "%s", ud_reg_tab[op->base - UD_R_AL]); +- break; +- +- case UD_OP_MEM: { +- +- int op_f = 0; +- +- if (syn_cast) +- opr_cast(u, op); +- +- mkasm(u, "["); +- +- if (u->pfx_seg) +- mkasm(u, "%s:", ud_reg_tab[u->pfx_seg - UD_R_AL]); +- +- if (op->base) { +- mkasm(u, "%s", ud_reg_tab[op->base - UD_R_AL]); +- op_f = 1; +- } +- +- if (op->index) { +- if (op_f) +- mkasm(u, "+"); +- mkasm(u, "%s", ud_reg_tab[op->index - UD_R_AL]); +- op_f = 1; +- } +- +- if (op->scale) +- mkasm(u, "*%d", op->scale); +- +- if (op->offset == 8) { +- if (op->lval.sbyte < 0) +- mkasm(u, "-0x%x", -op->lval.sbyte); +- else mkasm(u, "%s0x%x", (op_f) ? "+" : "", op->lval.sbyte); +- } +- else if (op->offset == 16) +- mkasm(u, "%s0x%x", (op_f) ? "+" : "", op->lval.uword); +- else if (op->offset == 32) { +- if (u->adr_mode == 64) { +- if (op->lval.sdword < 0) +- mkasm(u, "-0x%x", -op->lval.sdword); +- else mkasm(u, "%s0x%x", (op_f) ? "+" : "", op->lval.sdword); +- } +- else mkasm(u, "%s0x%lx", (op_f) ? "+" : "", (unsigned long)op->lval.udword); +- } +- else if (op->offset == 64) +- mkasm(u, "%s0x" FMT64 "x", (op_f) ? "+" : "", (uint64_t)op->lval.uqword); +- +- mkasm(u, "]"); +- break; +- } +- +- case UD_OP_IMM: { +- int64_t imm = 0; +- uint64_t sext_mask = 0xffffffffffffffffull; +- unsigned sext_size = op->size; +- +- if (syn_cast) +- opr_cast(u, op); +- switch (op->size) { +- case 8: imm = op->lval.sbyte; break; +- case 16: imm = op->lval.sword; break; +- case 32: imm = op->lval.sdword; break; +- case 64: imm = op->lval.sqword; break; +- } +- if ( P_SEXT( u->itab_entry->prefix ) ) { +- sext_size = u->operand[ 0 ].size; +- if ( u->mnemonic == UD_Ipush ) +- /* push sign-extends to operand size */ +- sext_size = u->opr_mode; +- } +- if ( sext_size < 64 ) +- sext_mask = ( 1ull << sext_size ) - 1; +- mkasm( u, "0x" FMT64 "x", (uint64_t)(imm & sext_mask) ); +- +- break; +- } +- +- +- case UD_OP_JIMM: +- if (syn_cast) opr_cast(u, op); +- switch (op->size) { +- case 8: +- mkasm(u, "0x" FMT64 "x", (uint64_t)(u->pc + op->lval.sbyte)); +- break; +- case 16: +- mkasm(u, "0x" FMT64 "x", (uint64_t)(( u->pc + op->lval.sword ) & 0xffff) ); +- break; +- case 32: +- mkasm(u, "0x" FMT64 "x", (uint64_t)(( u->pc + op->lval.sdword ) & 0xfffffffful) ); +- break; +- default:break; +- } +- break; +- +- case UD_OP_PTR: +- switch (op->size) { +- case 32: +- mkasm(u, "word 0x%x:0x%x", op->lval.ptr.seg, +- op->lval.ptr.off & 0xFFFF); +- break; +- case 48: +- mkasm(u, "dword 0x%x:0x%lx", op->lval.ptr.seg, +- (unsigned long)op->lval.ptr.off); +- break; +- } +- break; +- +- case UD_OP_CONST: +- if (syn_cast) opr_cast(u, op); +- mkasm(u, "%d", op->lval.udword); +- break; ++ case UD_OP_REG: ++ ud_asmprintf(u, "%s", ud_reg_tab[op->base - UD_R_AL]); ++ break; ++ ++ case UD_OP_MEM: ++ if (syn_cast) { ++ opr_cast(u, op); ++ } ++ ud_asmprintf(u, "["); ++ if (u->pfx_seg) { ++ ud_asmprintf(u, "%s:", ud_reg_tab[u->pfx_seg - UD_R_AL]); ++ } ++ if (op->base) { ++ ud_asmprintf(u, "%s", ud_reg_tab[op->base - UD_R_AL]); ++ } ++ if (op->index) { ++ ud_asmprintf(u, "%s%s", op->base != UD_NONE? "+" : "", ++ ud_reg_tab[op->index - UD_R_AL]); ++ if (op->scale) { ++ ud_asmprintf(u, "*%d", op->scale); ++ } ++ } ++ if (op->offset != 0) { ++ ud_syn_print_mem_disp(u, op, (op->base != UD_NONE || ++ op->index != UD_NONE) ? 1 : 0); ++ } ++ ud_asmprintf(u, "]"); ++ break; ++ ++ case UD_OP_IMM: ++ ud_syn_print_imm(u, op); ++ break; ++ ++ ++ case UD_OP_JIMM: ++ ud_syn_print_addr(u, ud_syn_rel_target(u, op)); ++ break; ++ ++ case UD_OP_PTR: ++ switch (op->size) { ++ case 32: ++ ud_asmprintf(u, "word 0x%x:0x%x", op->lval.ptr.seg, ++ op->lval.ptr.off & 0xFFFF); ++ break; ++ case 48: ++ ud_asmprintf(u, "dword 0x%x:0x%x", op->lval.ptr.seg, ++ op->lval.ptr.off); ++ break; ++ } ++ break; ++ ++ case UD_OP_CONST: ++ if (syn_cast) opr_cast(u, op); ++ ud_asmprintf(u, "%d", op->lval.udword); ++ break; + +- default: return; ++ default: return; + } + } + +@@ -181,98 +128,104 @@ + * translates to intel syntax + * ============================================================================= + */ +-extern void ud_translate_intel(struct ud* u) ++extern void ++ud_translate_intel(struct ud* u) + { +- /* -- prefixes -- */ +- + /* check if P_OSO prefix is used */ +- if (! P_OSO(u->itab_entry->prefix) && u->pfx_opr) { +- switch (u->dis_mode) { +- case 16: +- mkasm(u, "o32 "); +- break; +- case 32: +- case 64: +- mkasm(u, "o16 "); +- break; +- } ++ if (!P_OSO(u->itab_entry->prefix) && u->pfx_opr) { ++ switch (u->dis_mode) { ++ case 16: ud_asmprintf(u, "o32 "); break; ++ case 32: ++ case 64: ud_asmprintf(u, "o16 "); break; ++ } + } + + /* check if P_ASO prefix was used */ +- if (! P_ASO(u->itab_entry->prefix) && u->pfx_adr) { +- switch (u->dis_mode) { +- case 16: +- mkasm(u, "a32 "); +- break; +- case 32: +- mkasm(u, "a16 "); +- break; +- case 64: +- mkasm(u, "a32 "); +- break; +- } +- } +- +- if ( u->pfx_seg && +- u->operand[0].type != UD_OP_MEM && +- u->operand[1].type != UD_OP_MEM ) { +- mkasm(u, "%s ", ud_reg_tab[u->pfx_seg - UD_R_AL]); +- } +- if (u->pfx_lock) +- mkasm(u, "lock "); +- if (u->pfx_rep) +- mkasm(u, "rep "); +- if (u->pfx_repne) +- mkasm(u, "repne "); ++ if (!P_ASO(u->itab_entry->prefix) && u->pfx_adr) { ++ switch (u->dis_mode) { ++ case 16: ud_asmprintf(u, "a32 "); break; ++ case 32: ud_asmprintf(u, "a16 "); break; ++ case 64: ud_asmprintf(u, "a32 "); break; ++ } ++ } ++ ++ if (u->pfx_seg && ++ u->operand[0].type != UD_OP_MEM && ++ u->operand[1].type != UD_OP_MEM ) { ++ ud_asmprintf(u, "%s ", ud_reg_tab[u->pfx_seg - UD_R_AL]); ++ } ++ ++ if (u->pfx_lock) { ++ ud_asmprintf(u, "lock "); ++ } ++ if (u->pfx_rep) { ++ ud_asmprintf(u, "rep "); ++ } else if (u->pfx_repe) { ++ ud_asmprintf(u, "repe "); ++ } else if (u->pfx_repne) { ++ ud_asmprintf(u, "repne "); ++ } + + /* print the instruction mnemonic */ +- mkasm(u, "%s ", ud_lookup_mnemonic(u->mnemonic)); ++ ud_asmprintf(u, "%s", ud_lookup_mnemonic(u->mnemonic)); + +- /* operand 1 */ + if (u->operand[0].type != UD_NONE) { + int cast = 0; +- if ( u->operand[0].type == UD_OP_IMM && +- u->operand[1].type == UD_NONE ) +- cast = u->c1; +- if ( u->operand[0].type == UD_OP_MEM ) { +- cast = u->c1; +- if ( u->operand[1].type == UD_OP_IMM || +- u->operand[1].type == UD_OP_CONST ) +- cast = 1; +- if ( u->operand[1].type == UD_NONE ) +- cast = 1; +- if ( ( u->operand[0].size != u->operand[1].size ) && u->operand[1].size ) +- cast = 1; +- } else if ( u->operand[ 0 ].type == UD_OP_JIMM ) { +- if ( u->operand[ 0 ].size > 8 ) cast = 1; ++ ud_asmprintf(u, " "); ++ if (u->operand[0].type == UD_OP_MEM) { ++ if (u->operand[1].type == UD_OP_IMM || ++ u->operand[1].type == UD_OP_CONST || ++ u->operand[1].type == UD_NONE || ++ (u->operand[0].size != u->operand[1].size)) { ++ cast = 1; ++ } else if (u->operand[1].type == UD_OP_REG && ++ u->operand[1].base == UD_R_CL) { ++ switch (u->mnemonic) { ++ case UD_Ircl: ++ case UD_Irol: ++ case UD_Iror: ++ case UD_Ircr: ++ case UD_Ishl: ++ case UD_Ishr: ++ case UD_Isar: ++ cast = 1; ++ break; ++ default: break; ++ } ++ } + } +- gen_operand(u, &u->operand[0], cast); ++ gen_operand(u, &u->operand[0], cast); + } +- /* operand 2 */ ++ + if (u->operand[1].type != UD_NONE) { + int cast = 0; +- mkasm(u, ", "); +- if ( u->operand[1].type == UD_OP_MEM ) { +- cast = u->c1; +- +- if ( u->operand[0].type != UD_OP_REG ) +- cast = 1; +- if ( u->operand[0].size != u->operand[1].size && u->operand[1].size ) +- cast = 1; +- if ( u->operand[0].type == UD_OP_REG && +- u->operand[0].base >= UD_R_ES && +- u->operand[0].base <= UD_R_GS ) +- cast = 0; ++ ud_asmprintf(u, ", "); ++ if (u->operand[1].type == UD_OP_MEM && ++ u->operand[0].size != u->operand[1].size && ++ !ud_opr_is_sreg(&u->operand[0])) { ++ cast = 1; + } +- gen_operand(u, &u->operand[1], cast ); ++ gen_operand(u, &u->operand[1], cast); + } + +- /* operand 3 */ + if (u->operand[2].type != UD_NONE) { +- mkasm(u, ", "); +- gen_operand(u, &u->operand[2], u->c3); ++ int cast = 0; ++ ud_asmprintf(u, ", "); ++ if (u->operand[2].type == UD_OP_MEM && ++ u->operand[2].size != u->operand[1].size) { ++ cast = 1; ++ } ++ gen_operand(u, &u->operand[2], cast); ++ } ++ ++ if (u->operand[3].type != UD_NONE) { ++ ud_asmprintf(u, ", "); ++ gen_operand(u, &u->operand[3], 0); + } + } + + #endif // USE(UDIS86) + ++/* ++vim: set ts=2 sw=2 expandtab ++*/ +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_types.h b/Source/JavaScriptCore/disassembler/udis86/udis86_types.h +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_types.h 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_types.h 2019-06-10 00:48:46.000000000 +0300 +@@ -1,6 +1,6 @@ + /* udis86 - libudis86/types.h + * +- * Copyright (c) 2002-2009 Vivek Thampi ++ * Copyright (c) 2002-2013 Vivek Thampi + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without modification, +@@ -26,9 +26,23 @@ + #ifndef UD_TYPES_H + #define UD_TYPES_H + +-#ifndef __UD_STANDALONE__ ++#ifdef __KERNEL__ ++ /* ++ * -D__KERNEL__ is automatically passed on the command line when ++ * building something as part of the Linux kernel. Assume standalone ++ * mode. ++ */ ++# include ++# include ++# ifndef __UD_STANDALONE__ ++# define __UD_STANDALONE__ 1 ++# endif ++#endif /* __KERNEL__ */ ++ ++#if !defined(__UD_STANDALONE__) ++# include + # include +-#endif /* __UD_STANDALONE__ */ ++#endif + + /* gcc specific extensions */ + #ifdef __GNUC__ +@@ -37,26 +51,6 @@ + # define UD_ATTR_PACKED + #endif /* UD_ATTR_PACKED */ + +-#ifdef _MSC_VER +-# define FMT64 "%I64" +- typedef unsigned __int8 uint8_t; +- typedef unsigned __int16 uint16_t; +- typedef unsigned __int32 uint32_t; +- typedef unsigned __int64 uint64_t; +- typedef __int8 int8_t; +- typedef __int16 int16_t; +- typedef __int32 int32_t; +- typedef __int64 int64_t; +-#else +-# if defined(__GNU_LIBRARY__) && defined(__WORDSIZE) && (__WORDSIZE == 64) +-# define FMT64 "%l" +-# else +-# define FMT64 "%ll" +-# endif +-# ifndef __UD_STANDALONE__ +-# include +-# endif /* __UD_STANDALONE__ */ +-#endif + + /* ----------------------------------------------------------------------------- + * All possible "types" of objects in udis86. Order is Important! +@@ -67,152 +61,176 @@ + UD_NONE, + + /* 8 bit GPRs */ +- UD_R_AL, UD_R_CL, UD_R_DL, UD_R_BL, +- UD_R_AH, UD_R_CH, UD_R_DH, UD_R_BH, +- UD_R_SPL, UD_R_BPL, UD_R_SIL, UD_R_DIL, +- UD_R_R8B, UD_R_R9B, UD_R_R10B, UD_R_R11B, +- UD_R_R12B, UD_R_R13B, UD_R_R14B, UD_R_R15B, ++ UD_R_AL, UD_R_CL, UD_R_DL, UD_R_BL, ++ UD_R_AH, UD_R_CH, UD_R_DH, UD_R_BH, ++ UD_R_SPL, UD_R_BPL, UD_R_SIL, UD_R_DIL, ++ UD_R_R8B, UD_R_R9B, UD_R_R10B, UD_R_R11B, ++ UD_R_R12B, UD_R_R13B, UD_R_R14B, UD_R_R15B, + + /* 16 bit GPRs */ +- UD_R_AX, UD_R_CX, UD_R_DX, UD_R_BX, +- UD_R_SP, UD_R_BP, UD_R_SI, UD_R_DI, +- UD_R_R8W, UD_R_R9W, UD_R_R10W, UD_R_R11W, +- UD_R_R12W, UD_R_R13W, UD_R_R14W, UD_R_R15W, +- ++ UD_R_AX, UD_R_CX, UD_R_DX, UD_R_BX, ++ UD_R_SP, UD_R_BP, UD_R_SI, UD_R_DI, ++ UD_R_R8W, UD_R_R9W, UD_R_R10W, UD_R_R11W, ++ UD_R_R12W, UD_R_R13W, UD_R_R14W, UD_R_R15W, ++ + /* 32 bit GPRs */ +- UD_R_EAX, UD_R_ECX, UD_R_EDX, UD_R_EBX, +- UD_R_ESP, UD_R_EBP, UD_R_ESI, UD_R_EDI, +- UD_R_R8D, UD_R_R9D, UD_R_R10D, UD_R_R11D, +- UD_R_R12D, UD_R_R13D, UD_R_R14D, UD_R_R15D, +- ++ UD_R_EAX, UD_R_ECX, UD_R_EDX, UD_R_EBX, ++ UD_R_ESP, UD_R_EBP, UD_R_ESI, UD_R_EDI, ++ UD_R_R8D, UD_R_R9D, UD_R_R10D, UD_R_R11D, ++ UD_R_R12D, UD_R_R13D, UD_R_R14D, UD_R_R15D, ++ + /* 64 bit GPRs */ +- UD_R_RAX, UD_R_RCX, UD_R_RDX, UD_R_RBX, +- UD_R_RSP, UD_R_RBP, UD_R_RSI, UD_R_RDI, +- UD_R_R8, UD_R_R9, UD_R_R10, UD_R_R11, +- UD_R_R12, UD_R_R13, UD_R_R14, UD_R_R15, ++ UD_R_RAX, UD_R_RCX, UD_R_RDX, UD_R_RBX, ++ UD_R_RSP, UD_R_RBP, UD_R_RSI, UD_R_RDI, ++ UD_R_R8, UD_R_R9, UD_R_R10, UD_R_R11, ++ UD_R_R12, UD_R_R13, UD_R_R14, UD_R_R15, + + /* segment registers */ +- UD_R_ES, UD_R_CS, UD_R_SS, UD_R_DS, +- UD_R_FS, UD_R_GS, ++ UD_R_ES, UD_R_CS, UD_R_SS, UD_R_DS, ++ UD_R_FS, UD_R_GS, + + /* control registers*/ +- UD_R_CR0, UD_R_CR1, UD_R_CR2, UD_R_CR3, +- UD_R_CR4, UD_R_CR5, UD_R_CR6, UD_R_CR7, +- UD_R_CR8, UD_R_CR9, UD_R_CR10, UD_R_CR11, +- UD_R_CR12, UD_R_CR13, UD_R_CR14, UD_R_CR15, +- ++ UD_R_CR0, UD_R_CR1, UD_R_CR2, UD_R_CR3, ++ UD_R_CR4, UD_R_CR5, UD_R_CR6, UD_R_CR7, ++ UD_R_CR8, UD_R_CR9, UD_R_CR10, UD_R_CR11, ++ UD_R_CR12, UD_R_CR13, UD_R_CR14, UD_R_CR15, ++ + /* debug registers */ +- UD_R_DR0, UD_R_DR1, UD_R_DR2, UD_R_DR3, +- UD_R_DR4, UD_R_DR5, UD_R_DR6, UD_R_DR7, +- UD_R_DR8, UD_R_DR9, UD_R_DR10, UD_R_DR11, +- UD_R_DR12, UD_R_DR13, UD_R_DR14, UD_R_DR15, ++ UD_R_DR0, UD_R_DR1, UD_R_DR2, UD_R_DR3, ++ UD_R_DR4, UD_R_DR5, UD_R_DR6, UD_R_DR7, ++ UD_R_DR8, UD_R_DR9, UD_R_DR10, UD_R_DR11, ++ UD_R_DR12, UD_R_DR13, UD_R_DR14, UD_R_DR15, + + /* mmx registers */ +- UD_R_MM0, UD_R_MM1, UD_R_MM2, UD_R_MM3, +- UD_R_MM4, UD_R_MM5, UD_R_MM6, UD_R_MM7, ++ UD_R_MM0, UD_R_MM1, UD_R_MM2, UD_R_MM3, ++ UD_R_MM4, UD_R_MM5, UD_R_MM6, UD_R_MM7, + + /* x87 registers */ +- UD_R_ST0, UD_R_ST1, UD_R_ST2, UD_R_ST3, +- UD_R_ST4, UD_R_ST5, UD_R_ST6, UD_R_ST7, ++ UD_R_ST0, UD_R_ST1, UD_R_ST2, UD_R_ST3, ++ UD_R_ST4, UD_R_ST5, UD_R_ST6, UD_R_ST7, + + /* extended multimedia registers */ +- UD_R_XMM0, UD_R_XMM1, UD_R_XMM2, UD_R_XMM3, +- UD_R_XMM4, UD_R_XMM5, UD_R_XMM6, UD_R_XMM7, +- UD_R_XMM8, UD_R_XMM9, UD_R_XMM10, UD_R_XMM11, +- UD_R_XMM12, UD_R_XMM13, UD_R_XMM14, UD_R_XMM15, ++ UD_R_XMM0, UD_R_XMM1, UD_R_XMM2, UD_R_XMM3, ++ UD_R_XMM4, UD_R_XMM5, UD_R_XMM6, UD_R_XMM7, ++ UD_R_XMM8, UD_R_XMM9, UD_R_XMM10, UD_R_XMM11, ++ UD_R_XMM12, UD_R_XMM13, UD_R_XMM14, UD_R_XMM15, ++ ++ /* 256B multimedia registers */ ++ UD_R_YMM0, UD_R_YMM1, UD_R_YMM2, UD_R_YMM3, ++ UD_R_YMM4, UD_R_YMM5, UD_R_YMM6, UD_R_YMM7, ++ UD_R_YMM8, UD_R_YMM9, UD_R_YMM10, UD_R_YMM11, ++ UD_R_YMM12, UD_R_YMM13, UD_R_YMM14, UD_R_YMM15, + + UD_R_RIP, + + /* Operand Types */ +- UD_OP_REG, UD_OP_MEM, UD_OP_PTR, UD_OP_IMM, +- UD_OP_JIMM, UD_OP_CONST ++ UD_OP_REG, UD_OP_MEM, UD_OP_PTR, UD_OP_IMM, ++ UD_OP_JIMM, UD_OP_CONST + }; + + #include "udis86_itab.h" + ++union ud_lval { ++ int8_t sbyte; ++ uint8_t ubyte; ++ int16_t sword; ++ uint16_t uword; ++ int32_t sdword; ++ uint32_t udword; ++ int64_t sqword; ++ uint64_t uqword; ++ struct { ++ uint16_t seg; ++ uint32_t off; ++ } ptr; ++}; ++ + /* ----------------------------------------------------------------------------- + * struct ud_operand - Disassembled instruction Operand. + * ----------------------------------------------------------------------------- + */ +-struct ud_operand +-{ +- enum ud_type type; +- uint8_t size; +- union { +- int8_t sbyte; +- uint8_t ubyte; +- int16_t sword; +- uint16_t uword; +- int32_t sdword; +- uint32_t udword; +- int64_t sqword; +- uint64_t uqword; +- +- struct { +- uint16_t seg; +- uint32_t off; +- } ptr; +- } lval; +- +- enum ud_type base; +- enum ud_type index; +- uint8_t offset; +- uint8_t scale; ++struct ud_operand { ++ enum ud_type type; ++ uint16_t size; ++ enum ud_type base; ++ enum ud_type index; ++ uint8_t scale; ++ uint8_t offset; ++ union ud_lval lval; ++ /* ++ * internal use only ++ */ ++ uint64_t _legacy; /* this will be removed in 1.8 */ ++ uint8_t _oprcode; + }; + +-#define UD_STRING_BUFFER_SIZE 64 +- + /* ----------------------------------------------------------------------------- + * struct ud - The udis86 object. + * ----------------------------------------------------------------------------- + */ + struct ud + { +- int (*inp_hook) (struct ud*); +- uint8_t inp_curr; +- uint8_t inp_fill; ++ /* ++ * input buffering ++ */ ++ int (*inp_hook) (struct ud*); + #ifndef __UD_STANDALONE__ +- FILE* inp_file; ++ FILE* inp_file; + #endif +- uint8_t inp_ctr; +- uint8_t* inp_buff; +- uint8_t* inp_buff_end; +- uint8_t inp_end; +- void (*translator)(struct ud*); +- uint64_t insn_offset; +- char insn_hexcode[32]; +- char insn_buffer[UD_STRING_BUFFER_SIZE]; +- unsigned int insn_fill; +- uint8_t dis_mode; +- uint64_t pc; +- uint8_t vendor; +- struct map_entry* mapen; +- enum ud_mnemonic_code mnemonic; +- struct ud_operand operand[3]; +- uint8_t error; +- uint8_t pfx_rex; +- uint8_t pfx_seg; +- uint8_t pfx_opr; +- uint8_t pfx_adr; +- uint8_t pfx_lock; +- uint8_t pfx_rep; +- uint8_t pfx_repe; +- uint8_t pfx_repne; +- uint8_t pfx_insn; +- uint8_t default64; +- uint8_t opr_mode; +- uint8_t adr_mode; +- uint8_t br_far; +- uint8_t br_near; +- uint8_t implicit_addr; +- uint8_t c1; +- uint8_t c2; +- uint8_t c3; +- uint8_t inp_cache[256]; +- uint8_t inp_sess[64]; +- uint8_t have_modrm; +- uint8_t modrm; +- void * user_opaque_data; ++ const uint8_t* inp_buf; ++ size_t inp_buf_size; ++ size_t inp_buf_index; ++ uint8_t inp_curr; ++ size_t inp_ctr; ++ uint8_t inp_sess[64]; ++ int inp_end; ++ int inp_peek; ++ ++ void (*translator)(struct ud*); ++ uint64_t insn_offset; ++ char insn_hexcode[64]; ++ ++ /* ++ * Assembly output buffer ++ */ ++ char *asm_buf; ++ size_t asm_buf_size; ++ size_t asm_buf_fill; ++ char asm_buf_int[128]; ++ ++ /* ++ * Symbol resolver for use in the translation phase. ++ */ ++ const char* (*sym_resolver)(struct ud*, uint64_t addr, int64_t *offset); ++ ++ uint8_t dis_mode; ++ uint64_t pc; ++ uint8_t vendor; ++ enum ud_mnemonic_code mnemonic; ++ struct ud_operand operand[4]; ++ uint8_t error; ++ uint8_t _rex; ++ uint8_t pfx_rex; ++ uint8_t pfx_seg; ++ uint8_t pfx_opr; ++ uint8_t pfx_adr; ++ uint8_t pfx_lock; ++ uint8_t pfx_str; ++ uint8_t pfx_rep; ++ uint8_t pfx_repe; ++ uint8_t pfx_repne; ++ uint8_t opr_mode; ++ uint8_t adr_mode; ++ uint8_t br_far; ++ uint8_t br_near; ++ uint8_t have_modrm; ++ uint8_t modrm; ++ uint8_t modrm_offset; ++ uint8_t vex_op; ++ uint8_t vex_b1; ++ uint8_t vex_b2; ++ uint8_t primary_opcode; ++ void * user_opaque_data; + struct ud_itab_entry * itab_entry; + struct ud_lookup_table_list_entry *le; + }; +@@ -221,22 +239,22 @@ + * Type-definitions + * ----------------------------------------------------------------------------- + */ +-typedef enum ud_type ud_type_t; +-typedef enum ud_mnemonic_code ud_mnemonic_code_t; ++typedef enum ud_type ud_type_t; ++typedef enum ud_mnemonic_code ud_mnemonic_code_t; + +-typedef struct ud ud_t; +-typedef struct ud_operand ud_operand_t; ++typedef struct ud ud_t; ++typedef struct ud_operand ud_operand_t; + +-#define UD_SYN_INTEL ud_translate_intel +-#define UD_SYN_ATT ud_translate_att +-#define UD_EOI -1 +-#define UD_INP_CACHE_SZ 32 +-#define UD_VENDOR_AMD 0 +-#define UD_VENDOR_INTEL 1 +-#define UD_VENDOR_ANY 2 +- +-#define bail_out(ud,error_code) longjmp( (ud)->bailout, error_code ) +-#define try_decode(ud) if ( setjmp( (ud)->bailout ) == 0 ) +-#define catch_error() else ++#define UD_SYN_INTEL ud_translate_intel ++#define UD_SYN_ATT ud_translate_att ++#define UD_EOI (-1) ++#define UD_INP_CACHE_SZ 32 ++#define UD_VENDOR_AMD 0 ++#define UD_VENDOR_INTEL 1 ++#define UD_VENDOR_ANY 2 + + #endif ++ ++/* ++vim: set ts=2 sw=2 expandtab ++*/ +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/udis86_udint.h b/Source/JavaScriptCore/disassembler/udis86/udis86_udint.h +--- a/Source/JavaScriptCore/disassembler/udis86/udis86_udint.h 1970-01-01 02:00:00.000000000 +0200 ++++ b/Source/JavaScriptCore/disassembler/udis86/udis86_udint.h 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,98 @@ ++/* udis86 - libudis86/udint.h -- definitions for internal use only ++ * ++ * Copyright (c) 2002-2009 Vivek Thampi ++ * All rights reserved. ++ * ++ * Redistribution and use in source and binary forms, with or without modification, ++ * are permitted provided that the following conditions are met: ++ * ++ * * Redistributions of source code must retain the above copyright notice, ++ * this list of conditions and the following disclaimer. ++ * * Redistributions in binary form must reproduce the above copyright notice, ++ * this list of conditions and the following disclaimer in the documentation ++ * and/or other materials provided with the distribution. ++ * ++ * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ++ * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED ++ * WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE ++ * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR ++ * ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES ++ * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; ++ * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ++ * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT ++ * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS ++ * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ++ */ ++#ifndef _UDINT_H_ ++#define _UDINT_H_ ++ ++#include "udis86_types.h" ++ ++#ifdef HAVE_CONFIG_H ++# include ++#endif /* HAVE_CONFIG_H */ ++ ++#if defined(UD_DEBUG) && HAVE_ASSERT_H ++# define UD_ASSERT(_x) ASSERT(_x) ++#else ++# define UD_ASSERT(_x) ++#endif /* !HAVE_ASSERT_H */ ++ ++#if defined(UD_DEBUG) ++ #define UDERR(u, msg) \ ++ do { \ ++ (u)->error = 1; \ ++ fprintf(stderr, "decode-error: %s:%d: %s", \ ++ __FILE__, __LINE__, (msg)); \ ++ } while (0) ++#else ++ #define UDERR(u, m) \ ++ do { \ ++ (u)->error = 1; \ ++ } while (0) ++#endif /* !LOGERR */ ++ ++#define UD_RETURN_ON_ERROR(u) \ ++ do { \ ++ if ((u)->error != 0) { \ ++ return (u)->error; \ ++ } \ ++ } while (0) ++ ++#define UD_RETURN_WITH_ERROR(u, m) \ ++ do { \ ++ UDERR(u, m); \ ++ return (u)->error; \ ++ } while (0) ++ ++#ifndef __UD_STANDALONE__ ++# define UD_NON_STANDALONE(x) x ++#else ++# define UD_NON_STANDALONE(x) ++#endif ++ ++/* printf formatting int64 specifier */ ++#ifdef FMT64 ++# undef FMT64 ++#endif ++#if defined(_MSC_VER) || defined(__BORLANDC__) ++# define FMT64 "I64" ++#else ++# if defined(__APPLE__) ++# define FMT64 "ll" ++# elif defined(__amd64__) || defined(__x86_64__) ++# define FMT64 "l" ++# else ++# define FMT64 "ll" ++# endif /* !x64 */ ++#endif ++ ++/* define an inline macro */ ++#if defined(_MSC_VER) || defined(__BORLANDC__) ++# define UD_INLINE __inline /* MS Visual Studio requires __inline ++ instead of inline for C code */ ++#else ++# define UD_INLINE inline ++#endif ++ ++#endif /* _UDINT_H_ */ +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/ud_itab.py b/Source/JavaScriptCore/disassembler/udis86/ud_itab.py +--- a/Source/JavaScriptCore/disassembler/udis86/ud_itab.py 1970-01-01 02:00:00.000000000 +0200 ++++ b/Source/JavaScriptCore/disassembler/udis86/ud_itab.py 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,379 @@ ++# udis86 - scripts/ud_itab.py ++# ++# Copyright (c) 2009, 2013 Vivek Thampi ++# All rights reserved. ++# ++# Redistribution and use in source and binary forms, with or without modification, ++# are permitted provided that the following conditions are met: ++# ++# * Redistributions of source code must retain the above copyright notice, ++# this list of conditions and the following disclaimer. ++# * Redistributions in binary form must reproduce the above copyright notice, ++# this list of conditions and the following disclaimer in the documentation ++# and/or other materials provided with the distribution. ++# ++# THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ++# ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED ++# WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE ++# DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR ++# ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES ++# (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; ++# LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ++# ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT ++# (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS ++# SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ++ ++import os ++import sys ++from ud_opcode import UdOpcodeTable, UdOpcodeTables, UdInsnDef ++ ++class UdItabGenerator: ++ ++ OperandDict = { ++ "Av" : [ "OP_A" , "SZ_V" ], ++ "E" : [ "OP_E" , "SZ_NA" ], ++ "Eb" : [ "OP_E" , "SZ_B" ], ++ "Ew" : [ "OP_E" , "SZ_W" ], ++ "Ev" : [ "OP_E" , "SZ_V" ], ++ "Ed" : [ "OP_E" , "SZ_D" ], ++ "Ey" : [ "OP_E" , "SZ_Y" ], ++ "Eq" : [ "OP_E" , "SZ_Q" ], ++ "Ez" : [ "OP_E" , "SZ_Z" ], ++ "Fv" : [ "OP_F" , "SZ_V" ], ++ "G" : [ "OP_G" , "SZ_NA" ], ++ "Gb" : [ "OP_G" , "SZ_B" ], ++ "Gw" : [ "OP_G" , "SZ_W" ], ++ "Gv" : [ "OP_G" , "SZ_V" ], ++ "Gy" : [ "OP_G" , "SZ_Y" ], ++ "Gd" : [ "OP_G" , "SZ_D" ], ++ "Gq" : [ "OP_G" , "SZ_Q" ], ++ "Gz" : [ "OP_G" , "SZ_Z" ], ++ "M" : [ "OP_M" , "SZ_NA" ], ++ "Mb" : [ "OP_M" , "SZ_B" ], ++ "Mw" : [ "OP_M" , "SZ_W" ], ++ "Ms" : [ "OP_M" , "SZ_W" ], ++ "Md" : [ "OP_M" , "SZ_D" ], ++ "Mq" : [ "OP_M" , "SZ_Q" ], ++ "Mdq" : [ "OP_M" , "SZ_DQ" ], ++ "Mv" : [ "OP_M" , "SZ_V" ], ++ "Mt" : [ "OP_M" , "SZ_T" ], ++ "Mo" : [ "OP_M" , "SZ_O" ], ++ "MbRd" : [ "OP_MR" , "SZ_BD" ], ++ "MbRv" : [ "OP_MR" , "SZ_BV" ], ++ "MwRv" : [ "OP_MR" , "SZ_WV" ], ++ "MwRd" : [ "OP_MR" , "SZ_WD" ], ++ "MwRy" : [ "OP_MR" , "SZ_WY" ], ++ "MdRy" : [ "OP_MR" , "SZ_DY" ], ++ "I1" : [ "OP_I1" , "SZ_NA" ], ++ "I3" : [ "OP_I3" , "SZ_NA" ], ++ "Ib" : [ "OP_I" , "SZ_B" ], ++ "Iw" : [ "OP_I" , "SZ_W" ], ++ "Iv" : [ "OP_I" , "SZ_V" ], ++ "Iz" : [ "OP_I" , "SZ_Z" ], ++ "sIb" : [ "OP_sI" , "SZ_B" ], ++ "sIz" : [ "OP_sI" , "SZ_Z" ], ++ "sIv" : [ "OP_sI" , "SZ_V" ], ++ "Jv" : [ "OP_J" , "SZ_V" ], ++ "Jz" : [ "OP_J" , "SZ_Z" ], ++ "Jb" : [ "OP_J" , "SZ_B" ], ++ "R" : [ "OP_R" , "SZ_RDQ" ], ++ "C" : [ "OP_C" , "SZ_NA" ], ++ "D" : [ "OP_D" , "SZ_NA" ], ++ "S" : [ "OP_S" , "SZ_W" ], ++ "Ob" : [ "OP_O" , "SZ_B" ], ++ "Ow" : [ "OP_O" , "SZ_W" ], ++ "Ov" : [ "OP_O" , "SZ_V" ], ++ "U" : [ "OP_U" , "SZ_O" ], ++ "Ux" : [ "OP_U" , "SZ_X" ], ++ "V" : [ "OP_V" , "SZ_DQ" ], ++ "Vdq" : [ "OP_V" , "SZ_DQ" ], ++ "Vqq" : [ "OP_V" , "SZ_QQ" ], ++ "Vsd" : [ "OP_V" , "SZ_Q" ], ++ "Vx" : [ "OP_V" , "SZ_X" ], ++ "H" : [ "OP_H" , "SZ_X" ], ++ "Hx" : [ "OP_H" , "SZ_X" ], ++ "Hqq" : [ "OP_H" , "SZ_QQ" ], ++ "W" : [ "OP_W" , "SZ_DQ" ], ++ "Wdq" : [ "OP_W" , "SZ_DQ" ], ++ "Wqq" : [ "OP_W" , "SZ_QQ" ], ++ "Wsd" : [ "OP_W" , "SZ_Q" ], ++ "Wx" : [ "OP_W" , "SZ_X" ], ++ "L" : [ "OP_L" , "SZ_O" ], ++ "Lx" : [ "OP_L" , "SZ_X" ], ++ "MwU" : [ "OP_MU" , "SZ_WO" ], ++ "MdU" : [ "OP_MU" , "SZ_DO" ], ++ "MqU" : [ "OP_MU" , "SZ_QO" ], ++ "N" : [ "OP_N" , "SZ_Q" ], ++ "P" : [ "OP_P" , "SZ_Q" ], ++ "Q" : [ "OP_Q" , "SZ_Q" ], ++ "AL" : [ "OP_AL" , "SZ_B" ], ++ "AX" : [ "OP_AX" , "SZ_W" ], ++ "eAX" : [ "OP_eAX" , "SZ_Z" ], ++ "rAX" : [ "OP_rAX" , "SZ_V" ], ++ "CL" : [ "OP_CL" , "SZ_B" ], ++ "CX" : [ "OP_CX" , "SZ_W" ], ++ "eCX" : [ "OP_eCX" , "SZ_Z" ], ++ "rCX" : [ "OP_rCX" , "SZ_V" ], ++ "DL" : [ "OP_DL" , "SZ_B" ], ++ "DX" : [ "OP_DX" , "SZ_W" ], ++ "eDX" : [ "OP_eDX" , "SZ_Z" ], ++ "rDX" : [ "OP_rDX" , "SZ_V" ], ++ "R0b" : [ "OP_R0" , "SZ_B" ], ++ "R1b" : [ "OP_R1" , "SZ_B" ], ++ "R2b" : [ "OP_R2" , "SZ_B" ], ++ "R3b" : [ "OP_R3" , "SZ_B" ], ++ "R4b" : [ "OP_R4" , "SZ_B" ], ++ "R5b" : [ "OP_R5" , "SZ_B" ], ++ "R6b" : [ "OP_R6" , "SZ_B" ], ++ "R7b" : [ "OP_R7" , "SZ_B" ], ++ "R0w" : [ "OP_R0" , "SZ_W" ], ++ "R1w" : [ "OP_R1" , "SZ_W" ], ++ "R2w" : [ "OP_R2" , "SZ_W" ], ++ "R3w" : [ "OP_R3" , "SZ_W" ], ++ "R4w" : [ "OP_R4" , "SZ_W" ], ++ "R5w" : [ "OP_R5" , "SZ_W" ], ++ "R6w" : [ "OP_R6" , "SZ_W" ], ++ "R7w" : [ "OP_R7" , "SZ_W" ], ++ "R0v" : [ "OP_R0" , "SZ_V" ], ++ "R1v" : [ "OP_R1" , "SZ_V" ], ++ "R2v" : [ "OP_R2" , "SZ_V" ], ++ "R3v" : [ "OP_R3" , "SZ_V" ], ++ "R4v" : [ "OP_R4" , "SZ_V" ], ++ "R5v" : [ "OP_R5" , "SZ_V" ], ++ "R6v" : [ "OP_R6" , "SZ_V" ], ++ "R7v" : [ "OP_R7" , "SZ_V" ], ++ "R0z" : [ "OP_R0" , "SZ_Z" ], ++ "R1z" : [ "OP_R1" , "SZ_Z" ], ++ "R2z" : [ "OP_R2" , "SZ_Z" ], ++ "R3z" : [ "OP_R3" , "SZ_Z" ], ++ "R4z" : [ "OP_R4" , "SZ_Z" ], ++ "R5z" : [ "OP_R5" , "SZ_Z" ], ++ "R6z" : [ "OP_R6" , "SZ_Z" ], ++ "R7z" : [ "OP_R7" , "SZ_Z" ], ++ "R0y" : [ "OP_R0" , "SZ_Y" ], ++ "R1y" : [ "OP_R1" , "SZ_Y" ], ++ "R2y" : [ "OP_R2" , "SZ_Y" ], ++ "R3y" : [ "OP_R3" , "SZ_Y" ], ++ "R4y" : [ "OP_R4" , "SZ_Y" ], ++ "R5y" : [ "OP_R5" , "SZ_Y" ], ++ "R6y" : [ "OP_R6" , "SZ_Y" ], ++ "R7y" : [ "OP_R7" , "SZ_Y" ], ++ "ES" : [ "OP_ES" , "SZ_NA" ], ++ "CS" : [ "OP_CS" , "SZ_NA" ], ++ "DS" : [ "OP_DS" , "SZ_NA" ], ++ "SS" : [ "OP_SS" , "SZ_NA" ], ++ "GS" : [ "OP_GS" , "SZ_NA" ], ++ "FS" : [ "OP_FS" , "SZ_NA" ], ++ "ST0" : [ "OP_ST0" , "SZ_NA" ], ++ "ST1" : [ "OP_ST1" , "SZ_NA" ], ++ "ST2" : [ "OP_ST2" , "SZ_NA" ], ++ "ST3" : [ "OP_ST3" , "SZ_NA" ], ++ "ST4" : [ "OP_ST4" , "SZ_NA" ], ++ "ST5" : [ "OP_ST5" , "SZ_NA" ], ++ "ST6" : [ "OP_ST6" , "SZ_NA" ], ++ "ST7" : [ "OP_ST7" , "SZ_NA" ], ++ "NONE" : [ "OP_NONE" , "SZ_NA" ], ++ } ++ ++ # ++ # opcode prefix dictionary ++ # ++ PrefixDict = { ++ "rep" : "P_str", ++ "repz" : "P_strz", ++ "aso" : "P_aso", ++ "oso" : "P_oso", ++ "rexw" : "P_rexw", ++ "rexb" : "P_rexb", ++ "rexx" : "P_rexx", ++ "rexr" : "P_rexr", ++ "vexl" : "P_vexl", ++ "vexw" : "P_vexw", ++ "seg" : "P_seg", ++ "inv64" : "P_inv64", ++ "def64" : "P_def64", ++ "cast" : "P_cast", ++ } ++ ++ MnemonicAliases = ( "invalid", "3dnow", "none", "db", "pause" ) ++ ++ def __init__(self, tables): ++ self.tables = tables ++ self._insnIndexMap, i = {}, 0 ++ for insn in tables.getInsnList(): ++ self._insnIndexMap[insn], i = i, i + 1 ++ ++ self._tableIndexMap, i = {}, 0 ++ for table in tables.getTableList(): ++ self._tableIndexMap[table], i = i, i + 1 ++ ++ def getInsnIndex(self, insn): ++ assert isinstance(insn, UdInsnDef) ++ return self._insnIndexMap[insn] ++ ++ def getTableIndex(self, table): ++ assert isinstance(table, UdOpcodeTable) ++ return self._tableIndexMap[table] ++ ++ def getTableName(self, table): ++ return "ud_itab__%d" % self.getTableIndex(table) ++ ++ def genOpcodeTable(self, table, isGlobal=False): ++ """Emit Opcode Table in C. ++ """ ++ self.ItabC.write( "\n" ); ++ if not isGlobal: ++ self.ItabC.write('static ') ++ self.ItabC.write( "const uint16_t %s[] = {\n" % self.getTableName(table)) ++ for i in range(table.size()): ++ if i > 0 and i % 4 == 0: ++ self.ItabC.write( "\n" ) ++ if i % 4 == 0: ++ self.ItabC.write( " /* %2x */" % i) ++ e = table.entryAt(i) ++ if e is None: ++ self.ItabC.write("%12s," % "INVALID") ++ elif isinstance(e, UdOpcodeTable): ++ self.ItabC.write("%12s," % ("GROUP(%d)" % self.getTableIndex(e))) ++ elif isinstance(e, UdInsnDef): ++ self.ItabC.write("%12s," % self.getInsnIndex(e)) ++ self.ItabC.write( "\n" ) ++ self.ItabC.write( "};\n" ) ++ ++ ++ def genOpcodeTables(self): ++ tables = self.tables.getTableList() ++ for table in tables: ++ self.genOpcodeTable(table, table is self.tables.root) ++ ++ ++ def genOpcodeTablesLookupIndex(self): ++ self.ItabC.write( "\n\n" ); ++ self.ItabC.write( "struct ud_lookup_table_list_entry ud_lookup_table_list[] = {\n" ) ++ for table in self.tables.getTableList(): ++ f0 = self.getTableName(table) + "," ++ f1 = table.label() + "," ++ f2 = "\"%s\"" % table.meta() ++ self.ItabC.write(" /* %03d */ { %s %s %s },\n" % ++ (self.getTableIndex(table), f0, f1, f2)) ++ self.ItabC.write( "};" ) ++ ++ ++ def genInsnTable( self ): ++ self.ItabC.write( "struct ud_itab_entry ud_itab[] = {\n" ); ++ for insn in self.tables.getInsnList(): ++ opr_c = [ "O_NONE", "O_NONE", "O_NONE", "O_NONE" ] ++ pfx_c = [] ++ opr = insn.operands ++ for i in range(len(opr)): ++ if not (opr[i] in self.OperandDict.keys()): ++ print("error: invalid operand declaration: %s\n" % opr[i]) ++ opr_c[i] = "O_" + opr[i] ++ opr = "%s %s %s %s" % (opr_c[0] + ",", opr_c[1] + ",", ++ opr_c[2] + ",", opr_c[3]) ++ ++ for p in insn.prefixes: ++ if not ( p in self.PrefixDict.keys() ): ++ print("error: invalid prefix specification: %s \n" % pfx) ++ pfx_c.append( self.PrefixDict[p] ) ++ if len(insn.prefixes) == 0: ++ pfx_c.append( "P_none" ) ++ pfx = "|".join( pfx_c ) ++ ++ self.ItabC.write( " /* %04d */ { UD_I%s %s, %s },\n" \ ++ % ( self.getInsnIndex(insn), insn.mnemonic + ',', opr, pfx ) ) ++ self.ItabC.write( "};\n" ) ++ ++ ++ def getMnemonicsList(self): ++ mnemonics = self.tables.getMnemonicsList() ++ mnemonics.extend(self.MnemonicAliases) ++ return mnemonics ++ ++ def genMnemonicsList(self): ++ mnemonics = self.getMnemonicsList() ++ self.ItabC.write( "\n\n" ); ++ self.ItabC.write( "const char* ud_mnemonics_str[] = {\n " ) ++ self.ItabC.write( ",\n ".join( [ "\"%s\"" % m for m in mnemonics ] ) ) ++ self.ItabC.write( "\n};\n" ) ++ ++ ++ def genItabH( self, filePath ): ++ self.ItabH = open( filePath, "w" ) ++ ++ # Generate Table Type Enumeration ++ self.ItabH.write( "#ifndef UD_ITAB_H\n" ) ++ self.ItabH.write( "#define UD_ITAB_H\n\n" ) ++ ++ self.ItabH.write("/* itab.h -- generated by udis86:scripts/ud_itab.py, do no edit */\n\n") ++ ++ # table type enumeration ++ self.ItabH.write( "/* ud_table_type -- lookup table types (see decode.c) */\n" ) ++ self.ItabH.write( "enum ud_table_type {\n " ) ++ enum = UdOpcodeTable.getLabels() ++ self.ItabH.write( ",\n ".join( enum ) ) ++ self.ItabH.write( "\n};\n\n" ); ++ ++ # mnemonic enumeration ++ self.ItabH.write( "/* ud_mnemonic -- mnemonic constants */\n" ) ++ enum = "enum ud_mnemonic_code {\n " ++ enum += ",\n ".join( [ "UD_I%s" % m for m in self.getMnemonicsList() ] ) ++ enum += ",\n UD_MAX_MNEMONIC_CODE" ++ enum += "\n};\n" ++ self.ItabH.write( enum ) ++ self.ItabH.write( "\n" ) ++ ++ self.ItabH.write( "extern const char * ud_mnemonics_str[];\n" ) ++ ++ self.ItabH.write( "\n#endif /* UD_ITAB_H */\n" ) ++ ++ self.ItabH.close() ++ ++ ++ def genItabC(self, filePath): ++ self.ItabC = open(filePath, "w") ++ self.ItabC.write("/* itab.c -- generated by udis86:scripts/ud_itab.py, do no edit") ++ self.ItabC.write(" */\n"); ++ self.ItabC.write("#include \"udis86_decode.h\"\n\n"); ++ ++ self.ItabC.write("#define GROUP(n) (0x8000 | (n))\n") ++ self.ItabC.write("#define INVALID %d\n\n" % self.getInsnIndex(self.tables.invalidInsn)) ++ ++ self.genOpcodeTables() ++ self.genOpcodeTablesLookupIndex() ++ ++ # ++ # Macros defining short-names for operands ++ # ++ self.ItabC.write("\n\n/* itab entry operand definitions (for readability) */\n"); ++ operands = self.OperandDict.keys() ++ operands = sorted(operands) ++ for o in operands: ++ self.ItabC.write("#define O_%-7s { %-12s %-8s }\n" % ++ (o, self.OperandDict[o][0] + ",", self.OperandDict[o][1])); ++ self.ItabC.write("\n"); ++ ++ self.genInsnTable() ++ self.genMnemonicsList() ++ ++ self.ItabC.close() ++ ++ def genItab( self, location ): ++ self.genItabC(os.path.join(location, "udis86_itab.c")) ++ self.genItabH(os.path.join(location, "udis86_itab.h")) ++ ++def usage(): ++ print("usage: ud_itab.py ") ++ ++def main(): ++ ++ if len(sys.argv) != 3: ++ usage() ++ sys.exit(1) ++ ++ tables = UdOpcodeTables(xml=sys.argv[1]) ++ itab = UdItabGenerator(tables) ++ itab.genItab(sys.argv[2]) ++ ++if __name__ == '__main__': ++ main() +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/ud_opcode.py b/Source/JavaScriptCore/disassembler/udis86/ud_opcode.py +--- a/Source/JavaScriptCore/disassembler/udis86/ud_opcode.py 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/ud_opcode.py 2019-06-10 00:48:46.000000000 +0300 +@@ -1,6 +1,6 @@ + # udis86 - scripts/ud_opcode.py + # +-# Copyright (c) 2009 Vivek Thampi ++# Copyright (c) 2009, 2013 Vivek Thampi + # All rights reserved. + # + # Redistribution and use in source and binary forms, with or without modification, +@@ -23,213 +23,600 @@ + # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS + # SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +-class UdOpcodeTables: ++import os + +- TableInfo = { +- 'opctbl' : { 'name' : 'UD_TAB__OPC_TABLE', 'size' : 256 }, +- '/sse' : { 'name' : 'UD_TAB__OPC_SSE', 'size' : 4 }, +- '/reg' : { 'name' : 'UD_TAB__OPC_REG', 'size' : 8 }, +- '/rm' : { 'name' : 'UD_TAB__OPC_RM', 'size' : 8 }, +- '/mod' : { 'name' : 'UD_TAB__OPC_MOD', 'size' : 2 }, +- '/m' : { 'name' : 'UD_TAB__OPC_MODE', 'size' : 3 }, +- '/x87' : { 'name' : 'UD_TAB__OPC_X87', 'size' : 64 }, +- '/a' : { 'name' : 'UD_TAB__OPC_ASIZE', 'size' : 3 }, +- '/o' : { 'name' : 'UD_TAB__OPC_OSIZE', 'size' : 3 }, +- '/3dnow' : { 'name' : 'UD_TAB__OPC_3DNOW', 'size' : 256 }, +- 'vendor' : { 'name' : 'UD_TAB__OPC_VENDOR', 'size' : 3 }, +- } ++# Some compatibility stuff for supporting python 2.x as well as python 3.x ++def itemslist(dict): ++ try: ++ return dict.iteritems() # python 2.x ++ except AttributeError: ++ return list(dict.items()) # python 3.x ++ ++class UdInsnDef: ++ """An x86 instruction definition ++ """ ++ def __init__(self, **insnDef): ++ self.mnemonic = insnDef['mnemonic'] ++ self.prefixes = insnDef['prefixes'] ++ self.opcodes = insnDef['opcodes'] ++ self.operands = insnDef['operands'] ++ self._cpuid = insnDef['cpuid'] ++ self._opcexts = {} ++ ++ for opc in self.opcodes: ++ if opc.startswith('/'): ++ e, v = opc.split('=') ++ self._opcexts[e] = v ++ ++ def lookupPrefix(self, pfx): ++ """Lookup prefix (if any, None otherwise), by name""" ++ return True if pfx in self.prefixes else None ++ ++ ++ @property ++ def vendor(self): ++ return self._opcexts.get('/vendor', None) ++ ++ @property ++ def mode(self): ++ return self._opcexts.get('/m', None) ++ ++ @property ++ def osize(self): ++ return self._opcexts.get('/o', None) ++ ++ def isDef64(self): ++ return 'def64' in self.prefixes ++ ++ def __str__(self): ++ return self.mnemonic + " " + ', '.join(self.operands) + \ ++ " " + ' '.join(self.opcodes) ++ ++ ++class UdOpcodeTable: ++ """A single table of instruction definitions, indexed by ++ a decode field. ++ """ ++ ++ class CollisionError(Exception): ++ pass ++ ++ class IndexError(Exception): ++ """Invalid Index Error""" ++ pass ++ ++ @classmethod ++ def vendor2idx(cls, v): ++ return (0 if v == 'amd' ++ else (1 if v == 'intel' ++ else 2)) ++ ++ @classmethod ++ def vex2idx(cls, v): ++ if v.startswith("none_"): ++ v = v[5:] ++ vexOpcExtMap = { ++ 'none' : 0x0, ++ '0f' : 0x1, ++ '0f38' : 0x2, ++ '0f3a' : 0x3, ++ '66' : 0x4, ++ '66_0f' : 0x5, ++ '66_0f38' : 0x6, ++ '66_0f3a' : 0x7, ++ 'f3' : 0x8, ++ 'f3_0f' : 0x9, ++ 'f3_0f38' : 0xa, ++ 'f3_0f3a' : 0xb, ++ 'f2' : 0xc, ++ 'f2_0f' : 0xd, ++ 'f2_0f38' : 0xe, ++ 'f2_0f3a' : 0xf, ++ } ++ return vexOpcExtMap[v] + +- OpcodeTable0 = { +- 'type' : 'opctbl', +- 'entries' : {}, +- 'meta' : 'table0' ++ ++ # A mapping of opcode extensions to their representational ++ # values used in the opcode map. ++ OpcExtMap = { ++ '/rm' : lambda v: int(v, 16), ++ '/x87' : lambda v: int(v, 16), ++ '/3dnow' : lambda v: int(v, 16), ++ '/reg' : lambda v: int(v, 16), ++ # modrm.mod ++ # (!11, 11) => (00b, 01b) ++ '/mod' : lambda v: 0 if v == '!11' else 1, ++ # Mode extensions: ++ # (16, 32, 64) => (00, 01, 02) ++ '/o' : lambda v: (int(v) / 32), ++ '/a' : lambda v: (int(v) / 32), ++ # Disassembly mode ++ # (!64, 64) => (00b, 01b) ++ '/m' : lambda v: 1 if v == '64' else 0, ++ # SSE ++ # none => 0 ++ # f2 => 1 ++ # f3 => 2 ++ # 66 => 3 ++ '/sse' : lambda v: (0 if v == 'none' ++ else (((int(v, 16) & 0xf) + 1) / 2)), ++ # AVX ++ '/vex' : lambda v: UdOpcodeTable.vex2idx(v), ++ '/vexw' : lambda v: 0 if v == '0' else 1, ++ '/vexl' : lambda v: 0 if v == '0' else 1, ++ # Vendor ++ '/vendor': lambda v: UdOpcodeTable.vendor2idx(v) + } + +- OpcExtIndex = { + +- # ssef2, ssef3, sse66 +- 'sse': { +- 'none' : '00', +- 'f2' : '01', +- 'f3' : '02', +- '66' : '03' +- }, +- +- # /mod= +- 'mod': { +- '!11' : '00', +- '11' : '01' +- }, +- +- # /m=, /o=, /a= +- 'mode': { +- '16' : '00', +- '32' : '01', +- '64' : '02' +- }, +- +- 'vendor' : { +- 'amd' : '00', +- 'intel' : '01', +- 'any' : '02' +- } ++ _TableInfo = { ++ 'opctbl' : { 'label' : 'UD_TAB__OPC_TABLE', 'size' : 256 }, ++ '/sse' : { 'label' : 'UD_TAB__OPC_SSE', 'size' : 4 }, ++ '/reg' : { 'label' : 'UD_TAB__OPC_REG', 'size' : 8 }, ++ '/rm' : { 'label' : 'UD_TAB__OPC_RM', 'size' : 8 }, ++ '/mod' : { 'label' : 'UD_TAB__OPC_MOD', 'size' : 2 }, ++ '/m' : { 'label' : 'UD_TAB__OPC_MODE', 'size' : 2 }, ++ '/x87' : { 'label' : 'UD_TAB__OPC_X87', 'size' : 64 }, ++ '/a' : { 'label' : 'UD_TAB__OPC_ASIZE', 'size' : 3 }, ++ '/o' : { 'label' : 'UD_TAB__OPC_OSIZE', 'size' : 3 }, ++ '/3dnow' : { 'label' : 'UD_TAB__OPC_3DNOW', 'size' : 256 }, ++ '/vendor' : { 'label' : 'UD_TAB__OPC_VENDOR', 'size' : 3 }, ++ '/vex' : { 'label' : 'UD_TAB__OPC_VEX', 'size' : 16 }, ++ '/vexw' : { 'label' : 'UD_TAB__OPC_VEX_W', 'size' : 2 }, ++ '/vexl' : { 'label' : 'UD_TAB__OPC_VEX_L', 'size' : 2 }, + } + +- InsnTable = [] +- MnemonicsTable = [] + +- ThreeDNowTable = {} ++ def __init__(self, typ): ++ assert typ in self._TableInfo ++ self._typ = typ ++ self._entries = {} + +- def sizeOfTable( self, t ): +- return self.TableInfo[ t ][ 'size' ] + +- def nameOfTable( self, t ): +- return self.TableInfo[ t ][ 'name' ] +- +- # +- # Updates a table entry: If the entry doesn't exist +- # it will create the entry, otherwise, it will walk +- # while validating the path. +- # +- def updateTable( self, table, index, type, meta ): +- if not index in table[ 'entries' ]: +- table[ 'entries' ][ index ] = { 'type' : type, 'entries' : {}, 'meta' : meta } +- if table[ 'entries' ][ index ][ 'type' ] != type: +- raise NameError( "error: violation in opcode mapping (overwrite) %s with %s." % +- ( table[ 'entries' ][ index ][ 'type' ], type) ) +- return table[ 'entries' ][ index ] +- +- class Insn: +- """An abstract type representing an instruction in the opcode map. +- """ +- +- # A mapping of opcode extensions to their representational +- # values used in the opcode map. +- OpcExtMap = { +- '/rm' : lambda v: "%02x" % int(v, 16), +- '/x87' : lambda v: "%02x" % int(v, 16), +- '/3dnow' : lambda v: "%02x" % int(v, 16), +- '/reg' : lambda v: "%02x" % int(v, 16), +- # modrm.mod +- # (!11, 11) => (00, 01) +- '/mod' : lambda v: '00' if v == '!11' else '01', +- # Mode extensions: +- # (16, 32, 64) => (00, 01, 02) +- '/o' : lambda v: "%02x" % (int(v) / 32), +- '/a' : lambda v: "%02x" % (int(v) / 32), +- '/m' : lambda v: "%02x" % (int(v) / 32), +- '/sse' : lambda v: UdOpcodeTables.OpcExtIndex['sse'][v] +- } ++ def size(self): ++ return self._TableInfo[self._typ]['size'] ++ ++ def entries(self): ++ return itemslist(self._entries) ++ ++ def numEntries(self): ++ return len(self._entries.keys()) ++ ++ def label(self): ++ return self._TableInfo[self._typ]['label'] ++ ++ def typ(self): ++ return self._typ ++ ++ def meta(self): ++ return self._typ ++ ++ ++ def __str__(self): ++ return "table-%s" % self._typ ++ ++ ++ def add(self, opc, obj): ++ typ = UdOpcodeTable.getOpcodeTyp(opc) ++ idx = UdOpcodeTable.getOpcodeIdx(opc) ++ if self._typ != typ or idx in self._entries: ++ raise CollisionError() ++ self._entries[idx] = obj ++ ++ ++ def lookup(self, opc): ++ typ = UdOpcodeTable.getOpcodeTyp(opc) ++ idx = UdOpcodeTable.getOpcodeIdx(opc) ++ if self._typ != typ: ++ raise UdOpcodeTable.CollisionError("%s <-> %s" % (self._typ, typ)) ++ return self._entries.get(idx, None) + +- def __init__(self, prefixes, mnemonic, opcodes, operands, vendor): +- self.opcodes = opcodes +- self.prefixes = prefixes +- self.mnemonic = mnemonic +- self.operands = operands +- self.vendor = vendor +- self.opcext = {} +- +- ssePrefix = None +- if self.opcodes[0] in ('ssef2', 'ssef3', 'sse66'): +- ssePrefix = self.opcodes[0][3:] +- self.opcodes.pop(0) +- +- # do some preliminary decoding of the instruction type +- # 1byte, 2byte or 3byte instruction? +- self.nByteInsn = 1 +- if self.opcodes[0] == '0f': # 2byte +- # 2+ byte opcodes are always disambiguated by an +- # sse prefix, unless it is a 3d now instruction +- # which is 0f 0f ... +- if self.opcodes[1] != '0f' and ssePrefix is None: +- ssePrefix = 'none' +- if self.opcodes[1] in ('38', '3a'): # 3byte +- self.nByteInsn = 3 ++ ++ def entryAt(self, index): ++ """Returns the entry at a given index of the table, ++ None if there is none. Raises an exception if the ++ index is out of bounds. ++ """ ++ if index < self.size(): ++ return self._entries.get(index, None) ++ raise self.IndexError("index out of bounds: %s" % index) ++ ++ def setEntryAt(self, index, obj): ++ if index < self.size(): ++ self._entries[index] = obj ++ else: ++ raise self.IndexError("index out of bounds: %s" % index) ++ ++ @classmethod ++ def getOpcodeTyp(cls, opc): ++ if opc.startswith('/'): ++ return opc.split('=')[0] ++ else: ++ return 'opctbl' ++ ++ ++ @classmethod ++ def getOpcodeIdx(cls, opc): ++ if opc.startswith('/'): ++ typ, v = opc.split('=') ++ return cls.OpcExtMap[typ](v) ++ else: ++ # plain opctbl opcode ++ return int(opc, 16) ++ ++ ++ @classmethod ++ def getLabels(cls): ++ """Returns a list of all labels""" ++ return [cls._TableInfo[k]['label'] for k in cls._TableInfo.keys()] ++ ++ ++class UdOpcodeTables(object): ++ """Collection of opcode tables ++ """ ++ ++ class CollisionError(Exception): ++ def __init__(self, obj1, obj2): ++ self.obj1, self.obj2 = obj1, obj2 ++ ++ def newTable(self, typ): ++ """Create a new opcode table of a give type `typ`. """ ++ tbl = UdOpcodeTable(typ) ++ self._tables.append(tbl) ++ return tbl ++ ++ def mkTrie(self, opcodes, obj): ++ """Recursively contruct a trie entry mapping a string of ++ opcodes to an object. ++ """ ++ if len(opcodes) == 0: ++ return obj ++ opc = opcodes[0] ++ tbl = self.newTable(UdOpcodeTable.getOpcodeTyp(opc)) ++ tbl.add(opc, self.mkTrie(opcodes[1:], obj)) ++ return tbl ++ ++ def walk(self, tbl, opcodes): ++ """Walk down the opcode trie, starting at a given opcode ++ table, given a string of opcodes. Return None if unable ++ to walk, the object at the leaf otherwise. ++ """ ++ opc = opcodes[0] ++ e = tbl.lookup(opc) ++ if e is None: ++ return None ++ elif isinstance(e, UdOpcodeTable) and len(opcodes[1:]): ++ return self.walk(e, opcodes[1:]) ++ return e ++ ++ def map(self, tbl, opcodes, obj): ++ """Create a mapping from a given string of opcodes to an ++ object in the opcode trie. Constructs trie branches as ++ needed. ++ """ ++ opc = opcodes[0] ++ e = tbl.lookup(opc) ++ if e is None: ++ tbl.add(opc, self.mkTrie(opcodes[1:], obj)) ++ else: ++ if len(opcodes[1:]) == 0: ++ raise self.CollisionError(e, obj) ++ self.map(e, opcodes[1:], obj) ++ ++ def __init__(self, xml): ++ self._tables = [] ++ self._insns = [] ++ self._mnemonics = {} ++ ++ # The root table is always a 256 entry opctbl, indexed ++ # by a plain opcode byte ++ self.root = self.newTable('opctbl') ++ ++ if os.getenv("UD_OPCODE_DEBUG"): ++ self._logFh = open("opcodeTables.log", "w") ++ ++ # add an invalid instruction entry without any mapping ++ # in the opcode tables. ++ self.invalidInsn = UdInsnDef(mnemonic="invalid", opcodes=[], cpuid=[], ++ operands=[], prefixes=[]) ++ self._insns.append(self.invalidInsn) ++ ++ # Construct UdOpcodeTables object from the given ++ # udis86 optable.xml ++ for insn in self.__class__.parseOptableXML(xml): ++ self.addInsnDef(insn) ++ self.patchAvx2byte() ++ self.mergeSSENONE() ++ self.printStats() ++ ++ def log(self, s): ++ if os.getenv("UD_OPCODE_DEBUG"): ++ self._logFh.write(s + "\n") ++ ++ ++ def mergeSSENONE(self): ++ """Merge sse tables with only one entry for /sse=none ++ """ ++ for table in self._tables: ++ for k, e in table.entries(): ++ if isinstance(e, UdOpcodeTable) and e.typ() == '/sse': ++ if e.numEntries() == 1: ++ sse = e.lookup("/sse=none") ++ if sse: ++ table.setEntryAt(k, sse) ++ uniqTables = {} ++ def genTableList(tbl): ++ if tbl not in uniqTables: ++ self._tables.append(tbl) ++ uniqTables[tbl] = 1 ++ for k, e in tbl.entries(): ++ if isinstance(e, UdOpcodeTable): ++ genTableList(e) ++ self._tables = [] ++ genTableList(self.root) ++ ++ ++ def patchAvx2byte(self): ++ # create avx tables ++ for pp in (None, 'f2', 'f3', '66'): ++ for m in (None, '0f', '0f38', '0f3a'): ++ if pp is None and m is None: ++ continue ++ if pp is None: ++ vex = m ++ elif m is None: ++ vex = pp + else: +- self.nByteInsn = 2 +- +- # The opcode that indexes into the opcode table. +- self.opcode = self.opcodes[self.nByteInsn - 1] +- +- # Record opcode extensions +- for opcode in self.opcodes[self.nByteInsn:]: +- arg, val = opcode.split('=') +- self.opcext[arg] = self.OpcExtMap[arg](val) +- +- # Record sse extension: the reason sse extension is handled +- # separately is that historically sse was handled as a first +- # class opcode, not as an extension. Now that sse is handled +- # as an extension, we do the manual conversion here, as opposed +- # to modifying the opcode xml file. +- if ssePrefix is not None: +- self.opcext['/sse'] = self.OpcExtMap['/sse'](ssePrefix) +- +- def parse(self, table, insn): +- index = insn.opcodes[0]; +- if insn.nByteInsn > 1: +- assert index == '0f' +- table = self.updateTable(table, index, 'opctbl', '0f') +- index = insn.opcodes[1] +- +- if insn.nByteInsn == 3: +- table = self.updateTable(table, index, 'opctbl', index) +- index = insn.opcodes[2] ++ vex = pp + '_' + m ++ table = self.walk(self.root, ('c4', '/vex=' + vex)) ++ self.map(self.root, ('c5', '/vex=' + vex), table) ++ + +- # Walk down the tree, create levels as needed, for opcode +- # extensions. The order is important, and determines how ++ def addInsn(self, **insnDef): ++ ++ # Canonicalize opcode list ++ opcexts = insnDef['opcexts'] ++ opcodes = list(insnDef['opcodes']) ++ ++ # Re-order vex ++ if '/vex' in opcexts: ++ assert opcodes[0] == 'c4' or opcodes[0] == 'c5' ++ opcodes.insert(1, '/vex=' + opcexts['/vex']) ++ ++ # Add extensions. The order is important, and determines how + # well the opcode table is packed. Also note, /sse must be + # before /o, because /sse may consume operand size prefix + # affect the outcome of /o. +- for ext in ('/mod', '/x87', '/reg', '/rm', '/sse', +- '/o', '/a', '/m', '/3dnow'): +- if ext in insn.opcext: +- table = self.updateTable(table, index, ext, ext) +- index = insn.opcext[ext] +- +- # additional table for disambiguating vendor +- if len(insn.vendor): +- table = self.updateTable(table, index, 'vendor', insn.vendor) +- index = self.OpcExtIndex['vendor'][insn.vendor] +- +- # make leaf node entries +- leaf = self.updateTable(table, index, 'insn', '') +- +- leaf['mnemonic'] = insn.mnemonic +- leaf['prefixes'] = insn.prefixes +- leaf['operands'] = insn.operands +- +- # add instruction to linear table of instruction forms +- self.InsnTable.append({ 'prefixes' : insn.prefixes, +- 'mnemonic' : insn.mnemonic, +- 'operands' : insn.operands }) +- +- # add mnemonic to mnemonic table +- if not insn.mnemonic in self.MnemonicsTable: +- self.MnemonicsTable.append(insn.mnemonic) +- +- +- # Adds an instruction definition to the opcode tables +- def addInsnDef( self, prefixes, mnemonic, opcodes, operands, vendor ): +- insn = self.Insn(prefixes=prefixes, +- mnemonic=mnemonic, +- opcodes=opcodes, +- operands=operands, +- vendor=vendor) +- self.parse(self.OpcodeTable0, insn) +- +- def print_table( self, table, pfxs ): +- print("%s |" % pfxs) +- keys = table[ 'entries' ].keys() +- if ( len( keys ) ): +- keys.sort() +- for idx in keys: +- e = table[ 'entries' ][ idx ] +- if e[ 'type' ] == 'insn': +- print("%s |-<%s>" % ( pfxs, idx )), +- print("%s %s" % ( e[ 'mnemonic' ], ' '.join( e[ 'operands'] ))) ++ for ext in ('/mod', '/x87', '/reg', '/rm', '/sse', '/o', '/a', '/m', ++ '/vexw', '/vexl', '/3dnow', '/vendor'): ++ if ext in opcexts: ++ opcodes.append(ext + '=' + opcexts[ext]) ++ ++ insn = UdInsnDef(mnemonic = insnDef['mnemonic'], ++ prefixes = insnDef['prefixes'], ++ operands = insnDef['operands'], ++ opcodes = opcodes, ++ cpuid = insnDef['cpuid']) ++ try: ++ self.map(self.root, opcodes, insn) ++ except self.CollisionError as e: ++ self.pprint() ++ print(opcodes, insn, str(e.obj1), str(e.obj2)) ++ raise ++ except Exception as e: ++ self.pprint() ++ raise ++ self._insns.append(insn) ++ # add to lookup by mnemonic structure ++ if insn.mnemonic not in self._mnemonics: ++ self._mnemonics[insn.mnemonic] = [ insn ] ++ else: ++ self._mnemonics[insn.mnemonic].append(insn) ++ ++ ++ def addInsnDef(self, insnDef): ++ opcodes = [] ++ opcexts = {} ++ ++ # pack plain opcodes first, and collect opcode ++ # extensions ++ for opc in insnDef['opcodes']: ++ if not opc.startswith('/'): ++ opcodes.append(opc) + else: +- print("%s |-<%s> %s" % ( pfxs, idx, e['type'] )) +- self.print_table( e, pfxs + ' |' ) ++ e, v = opc.split('=') ++ opcexts[e] = v ++ ++ # treat vendor as an opcode extension ++ if len(insnDef['vendor']): ++ opcexts['/vendor'] = insnDef['vendor'][0] ++ ++ if insnDef['mnemonic'] in ('lds', 'les'): ++ # ++ # Massage lds and les, which share the same prefix as AVX ++ # instructions, to work well with the opcode tree. ++ # ++ opcexts['/vex'] = 'none' ++ elif '/vex' in opcexts: ++ # A proper avx instruction definition; make sure there are ++ # no legacy opcode extensions ++ assert '/sse' not in opcodes ++ ++ # make sure the opcode definitions don't already include ++ # the avx prefixes. ++ assert opcodes[0] not in ('c4', 'c5') ++ ++ # An avx only instruction is defined by the /vex= opcode ++ # extension. They do not include the c4 (long form) or ++ # c5 (short form) prefix. As part of opcode table generate, ++ # here we create the long form definition, and then patch ++ # the table for c5 in a later stage. ++ # Construct a long-form definition of the avx instruction ++ opcodes.insert(0, 'c4') ++ elif (opcodes[0] == '0f' and opcodes[1] != '0f' and ++ '/sse' not in opcexts): ++ # Make all 2-byte opcode form isntructions play nice with sse ++ # opcode maps. ++ opcexts['/sse'] = 'none' ++ ++ # legacy sse defs that get promoted to avx ++ fn = self.addInsn ++ if 'avx' in insnDef['cpuid'] and '/sse' in opcexts: ++ fn = self.addSSE2AVXInsn ++ ++ fn(mnemonic = insnDef['mnemonic'], ++ prefixes = insnDef['prefixes'], ++ opcodes = opcodes, ++ opcexts = opcexts, ++ operands = insnDef['operands'], ++ cpuid = insnDef['cpuid']) ++ ++ ++ def addSSE2AVXInsn(self, **insnDef): ++ """Add an instruction definition containing an avx cpuid bit, but ++ declared in its legacy SSE form. The function splits the ++ definition to create two new definitions, one for SSE and one ++ promoted to an AVX form. ++ """ ++ ++ # SSE ++ ssemnemonic = insnDef['mnemonic'] ++ sseopcodes = insnDef['opcodes'] ++ # remove vex opcode extensions ++ sseopcexts = dict([(e, v) for e, v in itemslist(insnDef['opcexts']) ++ if not e.startswith('/vex')]) ++ # strip out avx operands, preserving relative ordering ++ # of remaining operands ++ sseoperands = [opr for opr in insnDef['operands'] ++ if opr not in ('H', 'L')] ++ # strip out avx prefixes ++ sseprefixes = [pfx for pfx in insnDef['prefixes'] ++ if not pfx.startswith('vex')] ++ # strip out avx bits from cpuid ++ ssecpuid = [flag for flag in insnDef['cpuid'] ++ if not flag.startswith('avx')] ++ ++ self.addInsn(mnemonic = ssemnemonic, ++ prefixes = sseprefixes, ++ opcodes = sseopcodes, ++ opcexts = sseopcexts, ++ operands = sseoperands, ++ cpuid = ssecpuid) ++ ++ # AVX ++ vexmnemonic = 'v' + insnDef['mnemonic'] ++ vexprefixes = insnDef['prefixes'] ++ vexopcodes = ['c4'] ++ vexopcexts = dict([(e, insnDef['opcexts'][e]) ++ for e in insnDef['opcexts'] if e != '/sse']) ++ vexopcexts['/vex'] = insnDef['opcexts']['/sse'] + '_' + '0f' ++ if insnDef['opcodes'][1] == '38' or insnDef['opcodes'][1] == '3a': ++ vexopcexts['/vex'] += insnDef['opcodes'][1] ++ vexopcodes.extend(insnDef['opcodes'][2:]) ++ else: ++ vexopcodes.extend(insnDef['opcodes'][1:]) ++ vexoperands = [] ++ for o in insnDef['operands']: ++ # make the operand size explicit: x ++ if o in ('V', 'W', 'H', 'U'): ++ o = o + 'x' ++ vexoperands.append(o) ++ vexcpuid = [flag for flag in insnDef['cpuid'] ++ if not flag.startswith('sse')] ++ ++ self.addInsn(mnemonic = vexmnemonic, ++ prefixes = vexprefixes, ++ opcodes = vexopcodes, ++ opcexts = vexopcexts, ++ operands = vexoperands, ++ cpuid = vexcpuid) ++ ++ def getInsnList(self): ++ """Returns a list of all instructions in the collection""" ++ return self._insns ++ ++ ++ def getTableList(self): ++ """Returns a list of all tables in the collection""" ++ return self._tables ++ ++ def getMnemonicsList(self): ++ """Returns a sorted list of mnemonics""" ++ return sorted(self._mnemonics.keys()) ++ ++ ++ def pprint(self): ++ def printWalk(tbl, indent=""): ++ entries = tbl.entries() ++ for k, e in entries: ++ if isinstance(e, UdOpcodeTable): ++ self.log("%s |-<%02x> %s" % (indent, k, e)) ++ printWalk(e, indent + " |") ++ elif isinstance(e, UdInsnDef): ++ self.log("%s |-<%02x> %s" % (indent, k, e)) ++ printWalk(self.root) ++ ++ ++ def printStats(self): ++ tables = self.getTableList() ++ self.log("stats: ") ++ self.log(" Num tables = %d" % len(tables)) ++ self.log(" Num insnDefs = %d" % len(self.getInsnList())) ++ self.log(" Num insns = %d" % len(self.getMnemonicsList())) ++ ++ totalSize = 0 ++ totalEntries = 0 ++ for table in tables: ++ totalSize += table.size() ++ totalEntries += table.numEntries() ++ self.log(" Packing Ratio = %d%%" % ((totalEntries * 100) / totalSize)) ++ self.log("--------------------") ++ ++ self.pprint() ++ ++ ++ @staticmethod ++ def parseOptableXML(xml): ++ """Parse udis86 optable.xml file and return list of ++ instruction definitions. ++ """ ++ from xml.dom import minidom + +- def print_tree( self ): +- self.print_table( self.OpcodeTable0, '' ) ++ xmlDoc = minidom.parse(xml) ++ tlNode = xmlDoc.firstChild ++ insns = [] ++ ++ while tlNode and tlNode.localName != "x86optable": ++ tlNode = tlNode.nextSibling ++ ++ for insnNode in tlNode.childNodes: ++ if not insnNode.localName: ++ continue ++ if insnNode.localName != "instruction": ++ raise Exception("warning: invalid insn node - %s" % insnNode.localName) ++ mnemonic = insnNode.getElementsByTagName('mnemonic')[0].firstChild.data ++ vendor, cpuid = '', [] ++ ++ for node in insnNode.childNodes: ++ if node.localName == 'vendor': ++ vendor = node.firstChild.data.split() ++ elif node.localName == 'cpuid': ++ cpuid = node.firstChild.data.split() ++ ++ for node in insnNode.childNodes: ++ if node.localName == 'def': ++ insnDef = { 'pfx' : [] } ++ for node in node.childNodes: ++ if not node.localName: ++ continue ++ if node.localName in ('pfx', 'opc', 'opr', 'vendor', 'cpuid'): ++ insnDef[node.localName] = node.firstChild.data.split() ++ elif node.localName == 'mode': ++ insnDef['pfx'].extend(node.firstChild.data.split()) ++ insns.append({'prefixes' : insnDef.get('pfx', []), ++ 'mnemonic' : mnemonic, ++ 'opcodes' : insnDef.get('opc', []), ++ 'operands' : insnDef.get('opr', []), ++ 'vendor' : insnDef.get('vendor', vendor), ++ 'cpuid' : insnDef.get('cpuid', cpuid)}) ++ return insns +diff -Nuar a/Source/JavaScriptCore/disassembler/udis86/ud_optable.py b/Source/JavaScriptCore/disassembler/udis86/ud_optable.py +--- a/Source/JavaScriptCore/disassembler/udis86/ud_optable.py 2016-05-21 18:54:11.000000000 +0300 ++++ b/Source/JavaScriptCore/disassembler/udis86/ud_optable.py 1970-01-01 02:00:00.000000000 +0200 +@@ -1,103 +0,0 @@ +-# udis86 - scripts/ud_optable.py (optable.xml parser) +-# +-# Copyright (c) 2009 Vivek Thampi +-# All rights reserved. +-# +-# Redistribution and use in source and binary forms, with or without modification, +-# are permitted provided that the following conditions are met: +-# +-# * Redistributions of source code must retain the above copyright notice, +-# this list of conditions and the following disclaimer. +-# * Redistributions in binary form must reproduce the above copyright notice, +-# this list of conditions and the following disclaimer in the documentation +-# and/or other materials provided with the distribution. +-# +-# THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND +-# ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED +-# WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE +-# DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR +-# ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES +-# (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; +-# LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON +-# ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +-# (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS +-# SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +- +-import os +-import sys +-from xml.dom import minidom +- +-class UdOptableXmlParser: +- +- def parseDef( self, node ): +- ven = '' +- pfx = [] +- opc = [] +- opr = [] +- for def_node in node.childNodes: +- if not def_node.localName: +- continue +- if def_node.localName == 'pfx': +- pfx = def_node.firstChild.data.split(); +- elif def_node.localName == 'opc': +- opc = def_node.firstChild.data.split(); +- elif def_node.localName == 'opr': +- opr = def_node.firstChild.data.split(); +- elif def_node.localName == 'mode': +- pfx.extend( def_node.firstChild.data.split() ); +- elif def_node.localName == 'syn': +- pfx.extend( def_node.firstChild.data.split() ); +- elif def_node.localName == 'vendor': +- ven = ( def_node.firstChild.data ); +- else: +- print("warning: invalid node - %s" % def_node.localName) +- continue +- return ( pfx, opc, opr, ven ) +- +- def parse( self, xml, fn ): +- xmlDoc = minidom.parse( xml ) +- self.TlNode = xmlDoc.firstChild +- +- while self.TlNode and self.TlNode.localName != "x86optable": +- self.TlNode = self.TlNode.nextSibling +- +- for insnNode in self.TlNode.childNodes: +- if not insnNode.localName: +- continue +- if insnNode.localName != "instruction": +- print("warning: invalid insn node - %s" % insnNode.localName) +- continue +- +- mnemonic = insnNode.getElementsByTagName( 'mnemonic' )[ 0 ].firstChild.data +- vendor = '' +- +- for node in insnNode.childNodes: +- if node.localName == 'vendor': +- vendor = node.firstChild.data +- elif node.localName == 'def': +- ( prefixes, opcodes, operands, local_vendor ) = \ +- self.parseDef( node ) +- if ( len( local_vendor ) ): +- vendor = local_vendor +- # callback +- fn( prefixes, mnemonic, opcodes, operands, vendor ) +- +- +-def printFn( pfx, mnm, opc, opr, ven ): +- print('def: '), +- if len( pfx ): +- print(' '.join( pfx )), +- print("%s %s %s %s" % \ +- ( mnm, ' '.join( opc ), ' '.join( opr ), ven )) +- +- +-def parse( xml, callback ): +- parser = UdOptableXmlParser() +- parser.parse( xml, callback ) +- +-def main(): +- parser = UdOptableXmlParser() +- parser.parse( sys.argv[ 1 ], printFn ) +- +-if __name__ == "__main__": +- main() +diff -Nuar a/Source/JavaScriptCore/jit/ExecutableAllocator.h b/Source/JavaScriptCore/jit/ExecutableAllocator.h +--- a/Source/JavaScriptCore/jit/ExecutableAllocator.h 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/jit/ExecutableAllocator.h 2019-06-10 00:48:46.000000000 +0300 +@@ -76,7 +76,7 @@ + #if ENABLE(EXECUTABLE_ALLOCATOR_FIXED) + #if defined(FIXED_EXECUTABLE_MEMORY_POOL_SIZE_IN_MB) && FIXED_EXECUTABLE_MEMORY_POOL_SIZE_IN_MB > 0 + static const size_t fixedExecutableMemoryPoolSize = FIXED_EXECUTABLE_MEMORY_POOL_SIZE_IN_MB * 1024 * 1024; +-#elif CPU(ARM) ++#elif CPU(ARM) || CPU(MIPS) + static const size_t fixedExecutableMemoryPoolSize = 16 * 1024 * 1024; + #elif CPU(ARM64) + static const size_t fixedExecutableMemoryPoolSize = 32 * 1024 * 1024; +diff -Nuar a/Source/JavaScriptCore/parser/Parser.cpp b/Source/JavaScriptCore/parser/Parser.cpp +--- a/Source/JavaScriptCore/parser/Parser.cpp 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/parser/Parser.cpp 2019-06-10 00:48:46.000000000 +0300 +@@ -90,7 +90,7 @@ + return; + StringPrintStream stream; + printUnexpectedTokenText(stream); +- setErrorMessage(stream.toString()); ++ setErrorMessage(stream.toStringWithLatin1Fallback()); + } + + template template +@@ -104,7 +104,7 @@ + stream.print(". "); + } + stream.print(value1, "."); +- setErrorMessage(stream.toString()); ++ setErrorMessage(stream.toStringWithLatin1Fallback()); + } + + template template +@@ -118,7 +118,7 @@ + stream.print(". "); + } + stream.print(value1, value2, "."); +- setErrorMessage(stream.toString()); ++ setErrorMessage(stream.toStringWithLatin1Fallback()); + } + + template template +@@ -132,7 +132,7 @@ + stream.print(". "); + } + stream.print(value1, value2, value3, "."); +- setErrorMessage(stream.toString()); ++ setErrorMessage(stream.toStringWithLatin1Fallback()); + } + + template template +@@ -146,7 +146,7 @@ + stream.print(". "); + } + stream.print(value1, value2, value3, value4, "."); +- setErrorMessage(stream.toString()); ++ setErrorMessage(stream.toStringWithLatin1Fallback()); + } + + template template +@@ -160,7 +160,7 @@ + stream.print(". "); + } + stream.print(value1, value2, value3, value4, value5, "."); +- setErrorMessage(stream.toString()); ++ setErrorMessage(stream.toStringWithLatin1Fallback()); + } + + template template +@@ -174,7 +174,7 @@ + stream.print(". "); + } + stream.print(value1, value2, value3, value4, value5, value6, "."); +- setErrorMessage(stream.toString()); ++ setErrorMessage(stream.toStringWithLatin1Fallback()); + } + + template template +@@ -188,7 +188,7 @@ + stream.print(". "); + } + stream.print(value1, value2, value3, value4, value5, value6, value7, "."); +- setErrorMessage(stream.toString()); ++ setErrorMessage(stream.toStringWithLatin1Fallback()); + } + + template +diff -Nuar a/Source/JavaScriptCore/parser/Parser.h b/Source/JavaScriptCore/parser/Parser.h +--- a/Source/JavaScriptCore/parser/Parser.h 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/parser/Parser.h 2019-06-10 00:48:46.000000000 +0300 +@@ -1114,7 +1114,10 @@ + + void setErrorMessage(const String& message) + { ++ ASSERT_WITH_MESSAGE(!message.isEmpty(), "Attempted to set the empty string as an error message. Likely caused by invalid UTF8 used when creating the message."); + m_errorMessage = message; ++ if (m_errorMessage.isEmpty()) ++ m_errorMessage = ASCIILiteral("Unparseable script"); + } + + NEVER_INLINE void logError(bool); +diff -Nuar a/Source/JavaScriptCore/runtime/JSGenericTypedArrayViewConstructorInlines.h b/Source/JavaScriptCore/runtime/JSGenericTypedArrayViewConstructorInlines.h +--- a/Source/JavaScriptCore/runtime/JSGenericTypedArrayViewConstructorInlines.h 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/runtime/JSGenericTypedArrayViewConstructorInlines.h 2019-06-10 00:48:46.000000000 +0300 +@@ -32,6 +32,7 @@ + #include "JSCJSValueInlines.h" + #include "JSDataView.h" + #include "JSGenericTypedArrayViewConstructor.h" ++#include "JSGenericTypedArrayViewInlines.h" + #include "JSGlobalObject.h" + #include "StructureInlines.h" + +diff -Nuar a/Source/JavaScriptCore/runtime/JSGlobalObject.cpp b/Source/JavaScriptCore/runtime/JSGlobalObject.cpp +--- a/Source/JavaScriptCore/runtime/JSGlobalObject.cpp 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/runtime/JSGlobalObject.cpp 2019-06-10 00:48:46.000000000 +0300 +@@ -458,7 +458,10 @@ + putDirectWithoutTransition(vm, vm.propertyNames->TypeError, m_typeErrorConstructor.get(), DontEnum); + putDirectWithoutTransition(vm, vm.propertyNames->URIError, m_URIErrorConstructor.get(), DontEnum); + ++#if !PLATFORM(QT) ++ // Disable ES6 Proxy because our implementation is not compliant with what real world code expects + putDirectWithoutTransition(vm, vm.propertyNames->Proxy, ProxyConstructor::create(vm, ProxyConstructor::createStructure(vm, this, m_functionPrototype.get())), DontEnum); ++#endif + + + #define PUT_CONSTRUCTOR_FOR_SIMPLE_TYPE(capitalName, lowerName, properName, instanceType, jsName) \ +diff -Nuar a/Source/JavaScriptCore/Scripts/make-js-file-arrays.py b/Source/JavaScriptCore/Scripts/make-js-file-arrays.py +--- a/Source/JavaScriptCore/Scripts/make-js-file-arrays.py 1970-01-01 02:00:00.000000000 +0200 ++++ b/Source/JavaScriptCore/Scripts/make-js-file-arrays.py 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,97 @@ ++#!/usr/bin/env python ++# Copyright (C) 2014 Apple Inc. All rights reserved. ++# ++# Redistribution and use in source and binary forms, with or without ++# modification, are permitted provided that the following conditions ++# are met: ++# 1. Redistributions of source code must retain the above copyright ++# notice, this list of conditions and the following disclaimer. ++# 2. Redistributions in binary form must reproduce the above copyright ++# notice, this list of conditions and the following disclaimer in the ++# documentation and/or other materials provided with the distribution. ++# ++# THIS SOFTWARE IS PROVIDED BY APPLE INC. AND ITS CONTRIBUTORS ``AS IS'' AND ANY ++# EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED ++# WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE ++# DISCLAIMED. IN NO EVENT SHALL APPLE INC. OR ITS CONTRIBUTORS BE LIABLE FOR ANY ++# DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES ++# (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; ++# LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ++# ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT ++# (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS ++# SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. ++ ++import io ++import os ++from optparse import OptionParser ++from StringIO import StringIO ++from jsmin import JavascriptMinify ++ ++ ++def stringifyCodepoint(code): ++ if code < 128: ++ return '{0:d}'.format(code) ++ else: ++ return "'\\x{0:02x}'".format(code) ++ ++ ++def chunk(list, chunkSize): ++ for i in xrange(0, len(list), chunkSize): ++ yield list[i:i + chunkSize] ++ ++ ++def main(): ++ parser = OptionParser(usage="usage: %prog [options] header source [input [input...]]") ++ parser.add_option('--no-minify', action='store_true', help='Do not run the input files through jsmin') ++ parser.add_option('-n', '--namespace', help='Namespace to use') ++ (options, arguments) = parser.parse_args() ++ if not options.namespace: ++ print 'Error: must provide a namespace' ++ parser.print_usage() ++ exit(-1) ++ if len(arguments) < 3: ++ print 'Error: must provide at least 3 arguments' ++ parser.print_usage() ++ exit(-1) ++ ++ namespace = options.namespace ++ headerPath = arguments[0] ++ sourcePath = arguments[1] ++ inputPaths = arguments[2:] ++ ++ headerFile = open(headerPath, 'w') ++ print >> headerFile, 'namespace {0:s} {{'.format(namespace) ++ ++ sourceFile = open(sourcePath, 'w') ++ print >> sourceFile, '#include "{0:s}"'.format(os.path.basename(headerPath)) ++ print >> sourceFile, 'namespace {0:s} {{'.format(namespace) ++ ++ jsm = JavascriptMinify() ++ ++ for inputFileName in inputPaths: ++ inputStream = io.FileIO(inputFileName) ++ outputStream = StringIO() ++ ++ if not options.no_minify: ++ jsm.minify(inputStream, outputStream) ++ characters = outputStream.getvalue() ++ else: ++ characters = inputStream.read() ++ ++ size = len(characters) ++ variableName = os.path.splitext(os.path.basename(inputFileName))[0] ++ ++ print >> headerFile, 'extern const char {0:s}JavaScript[{1:d}];'.format(variableName, size) ++ print >> sourceFile, 'const char {0:s}JavaScript[{1:d}] = {{'.format(variableName, size) ++ ++ codepoints = map(ord, characters) ++ for codepointChunk in chunk(codepoints, 16): ++ print >> sourceFile, ' {0:s},'.format(','.join(map(stringifyCodepoint, codepointChunk))) ++ ++ print >> sourceFile, '};' ++ ++ print >> headerFile, '}} // namespace {0:s}'.format(namespace) ++ print >> sourceFile, '}} // namespace {0:s}'.format(namespace) ++ ++if __name__ == '__main__': ++ main() +diff -Nuar a/Source/JavaScriptCore/shell/PlatformQt.cmake b/Source/JavaScriptCore/shell/PlatformQt.cmake +--- a/Source/JavaScriptCore/shell/PlatformQt.cmake 2017-06-04 23:16:05.000000000 +0300 ++++ b/Source/JavaScriptCore/shell/PlatformQt.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -1,5 +1,5 @@ + if (QT_STATIC_BUILD) + list(APPEND JSC_LIBRARIES +- ${DEPEND_STATIC_LIBS} ++ ${STATIC_LIB_DEPENDENCIES} + ) + endif () +diff -Nuar a/Source/PlatformQt.cmake b/Source/PlatformQt.cmake +--- a/Source/PlatformQt.cmake 2017-06-16 02:36:48.000000000 +0300 ++++ b/Source/PlatformQt.cmake 2019-06-10 00:48:46.000000000 +0300 +@@ -32,6 +32,9 @@ + if (TARGET gtest) + target_compile_options(gtest PRIVATE -g0 -O1) + endif () ++ ++ target_compile_options(WebKit PRIVATE -g1 -O1 -fdebug-types-section) ++ target_compile_options(WebKit2 PRIVATE -g1 -O1 -fdebug-types-section) + endif () + + if (USE_MINIMAL_DEBUG_INFO_MSVC AND MSVC AND CMAKE_BUILD_TYPE STREQUAL "Debug") +@@ -71,6 +74,19 @@ + $ + ) + ++set(QTWEBKIT_PACKAGE_INIT " ++macro(find_dependency_with_major_and_minor _dep _major _minor) ++ find_dependency(\${_dep} \"\${_major}.\${_minor}\") ++ if (NOT(\"\${\${_dep}_VERSION_MAJOR}\" STREQUAL \"\${_major}\" AND \"\${\${_dep}_VERSION_MINOR}\" STREQUAL \"\${_minor}\")) ++ set(\${CMAKE_FIND_PACKAGE_NAME}_NOT_FOUND_MESSAGE \"\${CMAKE_FIND_PACKAGE_NAME} could not be found because dependency \${dep} is required to have exact version \${_major}.\${_minor}.x.\") ++ set(\${CMAKE_FIND_PACKAGE_NAME}_FOUND False) ++ return() ++ endif () ++endmacro () ++ ++#################################################################################### ++") ++ + set(_package_footer_template " + ####### Expanded from QTWEBKIT_PACKAGE_FOOTER variable ####### + +diff -Nuar a/Source/Qt5WebKitConfig.cmake.in b/Source/Qt5WebKitConfig.cmake.in +--- a/Source/Qt5WebKitConfig.cmake.in 2017-06-04 23:16:06.000000000 +0300 ++++ b/Source/Qt5WebKitConfig.cmake.in 2019-06-10 00:48:46.000000000 +0300 +@@ -1,8 +1,9 @@ + @PACKAGE_INIT@ ++@QTWEBKIT_PACKAGE_INIT@ + +-find_dependency(Qt5Core @Qt5_VERSION@ EXACT) +-find_dependency(Qt5Gui @Qt5_VERSION@ EXACT) +-find_dependency(Qt5Network @Qt5_VERSION@ EXACT) ++find_dependency_with_major_and_minor(Qt5Core @Qt5_VERSION_MAJOR@ @Qt5_VERSION_MINOR@) ++find_dependency_with_major_and_minor(Qt5Gui @Qt5_VERSION_MAJOR@ @Qt5_VERSION_MINOR@) ++find_dependency_with_major_and_minor(Qt5Network @Qt5_VERSION_MAJOR@ @Qt5_VERSION_MINOR@) + + include("${CMAKE_CURRENT_LIST_DIR}/WebKitTargets.cmake") + +diff -Nuar a/Source/Qt5WebKitWidgetsConfig.cmake.in b/Source/Qt5WebKitWidgetsConfig.cmake.in +--- a/Source/Qt5WebKitWidgetsConfig.cmake.in 2017-06-04 23:16:06.000000000 +0300 ++++ b/Source/Qt5WebKitWidgetsConfig.cmake.in 2019-06-10 00:48:46.000000000 +0300 +@@ -1,11 +1,8 @@ + @PACKAGE_INIT@ +- +-find_dependency(Qt5Core @Qt5_VERSION@ EXACT) +-find_dependency(Qt5Gui @Qt5_VERSION@ EXACT) +-find_dependency(Qt5Network @Qt5_VERSION@ EXACT) +-find_dependency(Qt5Widgets @Qt5_VERSION@ EXACT) ++@QTWEBKIT_PACKAGE_INIT@ + + find_dependency(Qt5WebKit @PROJECT_VERSION_STRING@ EXACT) ++find_dependency_with_major_and_minor(Qt5Widgets @Qt5_VERSION_MAJOR@ @Qt5_VERSION_MINOR@) + + include("${CMAKE_CURRENT_LIST_DIR}/Qt5WebKitWidgetsTargets.cmake") + +diff -Nuar a/Source/qtwebkit.qdocconf b/Source/qtwebkit.qdocconf +--- a/Source/qtwebkit.qdocconf 2016-08-12 01:03:09.000000000 +0300 ++++ b/Source/qtwebkit.qdocconf 2019-06-10 00:48:46.000000000 +0300 +@@ -35,3 +35,5 @@ + imagedirs = WebKit/qt/docs + + depends += qtcore qtwidgets qtgui qtscript qtdoc qtprintsupport qtxml qtwebkitexamples qtquickcontrols ++ ++tagfile = qtwebkit.tags +diff -Nuar a/Source/ThirdParty/brotli/CMakeLists.txt b/Source/ThirdParty/brotli/CMakeLists.txt +--- a/Source/ThirdParty/brotli/CMakeLists.txt 2017-06-04 23:16:06.000000000 +0300 ++++ b/Source/ThirdParty/brotli/CMakeLists.txt 2019-06-10 00:48:46.000000000 +0300 +@@ -1,13 +1,15 @@ + set(BROTLI_DIR "${THIRDPARTY_DIR}/brotli") + + set(BROTLI_INCLUDE_DIRECTORIES ++ "${BROTLI_DIR}/common" + "${BROTLI_DIR}/dec" ++ "${BROTLI_DIR}/include" + ) + + set(BROTLI_SOURCES ++ ${BROTLI_DIR}/common/dictionary.c + ${BROTLI_DIR}/dec/bit_reader.c + ${BROTLI_DIR}/dec/decode.c +- ${BROTLI_DIR}/dec/dictionary.c + ${BROTLI_DIR}/dec/huffman.c + ${BROTLI_DIR}/dec/state.c + ) +diff -Nuar a/Source/ThirdParty/brotli/common/constants.h b/Source/ThirdParty/brotli/common/constants.h +--- a/Source/ThirdParty/brotli/common/constants.h 1970-01-01 02:00:00.000000000 +0200 ++++ b/Source/ThirdParty/brotli/common/constants.h 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,57 @@ ++/* Copyright 2016 Google Inc. All Rights Reserved. ++ ++ Distributed under MIT license. ++ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT ++*/ ++ ++#ifndef BROTLI_COMMON_CONSTANTS_H_ ++#define BROTLI_COMMON_CONSTANTS_H_ ++ ++/* Specification: 7.3. Encoding of the context map */ ++#define BROTLI_CONTEXT_MAP_MAX_RLE 16 ++ ++/* Specification: 2. Compressed representation overview */ ++#define BROTLI_MAX_NUMBER_OF_BLOCK_TYPES 256 ++ ++/* Specification: 3.3. Alphabet sizes: insert-and-copy length */ ++#define BROTLI_NUM_LITERAL_SYMBOLS 256 ++#define BROTLI_NUM_COMMAND_SYMBOLS 704 ++#define BROTLI_NUM_BLOCK_LEN_SYMBOLS 26 ++#define BROTLI_MAX_CONTEXT_MAP_SYMBOLS (BROTLI_MAX_NUMBER_OF_BLOCK_TYPES + \ ++ BROTLI_CONTEXT_MAP_MAX_RLE) ++#define BROTLI_MAX_BLOCK_TYPE_SYMBOLS (BROTLI_MAX_NUMBER_OF_BLOCK_TYPES + 2) ++ ++/* Specification: 3.5. Complex prefix codes */ ++#define BROTLI_REPEAT_PREVIOUS_CODE_LENGTH 16 ++#define BROTLI_REPEAT_ZERO_CODE_LENGTH 17 ++#define BROTLI_CODE_LENGTH_CODES (BROTLI_REPEAT_ZERO_CODE_LENGTH + 1) ++/* "code length of 8 is repeated" */ ++#define BROTLI_INITIAL_REPEATED_CODE_LENGTH 8 ++ ++/* Specification: 4. Encoding of distances */ ++#define BROTLI_NUM_DISTANCE_SHORT_CODES 16 ++#define BROTLI_MAX_NPOSTFIX 3 ++#define BROTLI_MAX_NDIRECT 120 ++#define BROTLI_MAX_DISTANCE_BITS 24U ++/* BROTLI_NUM_DISTANCE_SYMBOLS == 520 */ ++#define BROTLI_NUM_DISTANCE_SYMBOLS (BROTLI_NUM_DISTANCE_SHORT_CODES + \ ++ BROTLI_MAX_NDIRECT + \ ++ (BROTLI_MAX_DISTANCE_BITS << \ ++ (BROTLI_MAX_NPOSTFIX + 1))) ++/* Distance that is guaranteed to be representable in any stream. */ ++#define BROTLI_MAX_DISTANCE 0x3FFFFFC ++ ++/* 7.1. Context modes and context ID lookup for literals */ ++/* "context IDs for literals are in the range of 0..63" */ ++#define BROTLI_LITERAL_CONTEXT_BITS 6 ++ ++/* 7.2. Context ID for distances */ ++#define BROTLI_DISTANCE_CONTEXT_BITS 2 ++ ++/* 9.1. Format of the Stream Header */ ++/* Number of slack bytes for window size. Don't confuse ++ with BROTLI_NUM_DISTANCE_SHORT_CODES. */ ++#define BROTLI_WINDOW_GAP 16 ++#define BROTLI_MAX_BACKWARD_LIMIT(W) (((size_t)1 << (W)) - BROTLI_WINDOW_GAP) ++ ++#endif /* BROTLI_COMMON_CONSTANTS_H_ */ +diff -Nuar a/Source/ThirdParty/brotli/common/dictionary.bin b/Source/ThirdParty/brotli/common/dictionary.bin +--- a/Source/ThirdParty/brotli/common/dictionary.bin 1970-01-01 02:00:00.000000000 +0200 ++++ b/Source/ThirdParty/brotli/common/dictionary.bin 2019-06-10 00:48:46.000000000 +0300 +@@ -0,0 +1,432 @@ ++timedownlifeleftbackcodedatashowonlysitecityopenjustlikefreeworktextyearoverbodyloveformbookplaylivelinehelphomesidemorewordlongthemviewfindpagedaysfullheadtermeachareafromtruemarkableuponhighdatelandnewsevennextcasebothpostusedmadehandherewhatnameLinkblogsizebaseheldmakemainuser') +holdendswithNewsreadweresigntakehavegameseencallpathwellplusmenufilmpartjointhislistgoodneedwayswestjobsmindalsologorichuseslastteamarmyfoodkingwilleastwardbestfirePageknowaway.pngmovethanloadgiveselfnotemuchfeedmanyrockicononcelookhidediedHomerulehostajaxinfoclublawslesshalfsomesuchzone100%onescareTimeracebluefourweekfacehopegavehardlostwhenparkkeptpassshiproomHTMLplanTypedonesavekeepflaglinksoldfivetookratetownjumpthusdarkcardfilefearstaykillthatfallautoever.comtalkshopvotedeepmoderestturnbornbandfellroseurl(skinrolecomeactsagesmeetgold.jpgitemvaryfeltthensenddropViewcopy1.0"stopelseliestourpack.gifpastcss?graymean>rideshotlatesaidroadvar feeljohnrickportfast'UA-deadpoorbilltypeU.S.woodmust2px;Inforankwidewantwalllead[0];paulwavesure$('#waitmassarmsgoesgainlangpaid!-- lockunitrootwalkfirmwifexml"songtest20pxkindrowstoolfontmailsafestarmapscorerainflowbabyspansays4px;6px;artsfootrealwikiheatsteptriporg/lakeweaktoldFormcastfansbankveryrunsjulytask1px;goalgrewslowedgeid="sets5px;.js?40pxif (soonseatnonetubezerosentreedfactintogiftharm18pxcamehillboldzoomvoideasyringfillpeakinitcost3px;jacktagsbitsrolleditknewnearironfreddiskwentsoilputs/js/holyT22:ISBNT20:adamsees

json', 'contT21: RSSloopasiamoon

soulLINEfortcartT14:

80px!--<9px;T04:mike:46ZniceinchYorkricezh:'));puremageparatonebond:37Z_of_']);000,zh:tankyardbowlbush:56ZJava30px ++|} ++%C3%:34ZjeffEXPIcashvisagolfsnowzh:quer.csssickmeatmin.binddellhirepicsrent:36ZHTTP-201fotowolfEND xbox:54ZBODYdick; ++} ++exit:35Zvarsbeat'});diet999;anne}}sonyguysfuckpipe|- ++!002)ndow[1];[]; ++Log salt ++ bangtrimbath){ ++00px ++});ko:feesad> s:// [];tollplug(){ ++{ ++ .js'200pdualboat.JPG); ++}quot); ++ ++'); ++ ++} 201420152016201720182019202020212022202320242025202620272028202920302031203220332034203520362037201320122011201020092008200720062005200420032002200120001999199819971996199519941993199219911990198919881987198619851984198319821981198019791978197719761975197419731972197119701969196819671966196519641963196219611960195919581957195619551954195319521951195010001024139400009999comomásesteestaperotodohacecadaañobiendíaasívidacasootroforosolootracualdijosidograntipotemadebealgoquéestonadatrespococasabajotodasinoaguapuesunosantediceluisellamayozonaamorpisoobraclicellodioshoracasiзанаомрарутанепоотизнодотожеонихНаеебымыВысовывоНообПолиниРФНеМытыОнимдаЗаДаНуОбтеИзейнуммТыужفيأنمامعكلأورديافىهولملكاولهبسالإنهيأيقدهلثمبهلوليبلايبكشيامأمنتبيلنحبهممشوشfirstvideolightworldmediawhitecloseblackrightsmallbooksplacemusicfieldorderpointvalueleveltableboardhousegroupworksyearsstatetodaywaterstartstyledeathpowerphonenighterrorinputabouttermstitletoolseventlocaltimeslargewordsgamesshortspacefocusclearmodelblockguideradiosharewomenagainmoneyimagenamesyounglineslatercolorgreenfront&watchforcepricerulesbeginaftervisitissueareasbelowindextotalhourslabelprintpressbuiltlinksspeedstudytradefoundsenseundershownformsrangeaddedstillmovedtakenaboveflashfixedoftenotherviewschecklegalriveritemsquickshapehumanexistgoingmoviethirdbasicpeacestagewidthloginideaswrotepagesusersdrivestorebreaksouthvoicesitesmonthwherebuildwhichearthforumthreesportpartyClicklowerlivesclasslayerentrystoryusagesoundcourtyour birthpopuptypesapplyImagebeinguppernoteseveryshowsmeansextramatchtrackknownearlybegansuperpapernorthlearngivennamedendedTermspartsGroupbrandusingwomanfalsereadyaudiotakeswhile.com/livedcasesdailychildgreatjudgethoseunitsneverbroadcoastcoverapplefilescyclesceneplansclickwritequeenpieceemailframeolderphotolimitcachecivilscaleenterthemetheretouchboundroyalaskedwholesincestock namefaithheartemptyofferscopeownedmightalbumthinkbloodarraymajortrustcanonunioncountvalidstoneStyleLoginhappyoccurleft:freshquitefilmsgradeneedsurbanfightbasishoverauto;route.htmlmixedfinalYour slidetopicbrownalonedrawnsplitreachRightdatesmarchquotegoodsLinksdoubtasyncthumballowchiefyouthnovel10px;serveuntilhandsCheckSpacequeryjamesequaltwice0,000Startpanelsongsroundeightshiftworthpostsleadsweeksavoidthesemilesplanesmartalphaplantmarksratesplaysclaimsalestextsstarswrong

thing.org/multiheardPowerstandtokensolid(thisbringshipsstafftriedcallsfullyfactsagentThis //-->adminegyptEvent15px;Emailtrue"crossspentblogsbox">notedleavechinasizesguestrobotheavytrue,sevengrandcrimesignsawaredancephase> ++ ++ ++name=diegopage swiss--> ++ ++#fff;">Log.com"treatsheet) && 14px;sleepntentfiledja:id="cName"worseshots-box-delta ++<bears:48Z spendbakershops= "";php">ction13px;brianhellosize=o=%2F joinmaybe, fjsimg" ")[0]MTopBType"newlyDanskczechtrailknowsfaq">zh-cn10); ++-1");type=bluestrulydavis.js';> ++ ++form jesus100% menu. ++ ++walesrisksumentddingb-likteachgif" vegasdanskeestishqipsuomisobredesdeentretodospuedeañosestátienehastaotrospartedondenuevohacerformamismomejormundoaquídíassóloayudafechatodastantomenosdatosotrassitiomuchoahoralugarmayorestoshorastenerantesfotosestaspaísnuevasaludforosmedioquienmesespoderchileserávecesdecirjoséestarventagrupohechoellostengoamigocosasnivelgentemismaairesjuliotemashaciafavorjuniolibrepuntobuenoautorabrilbuenatextomarzosaberlistaluegocómoenerojuegoperúhaberestoynuncamujervalorfueralibrogustaigualvotoscasosguíapuedosomosavisousteddebennochebuscafaltaeurosseriedichocursoclavecasasleónplazolargoobrasvistaapoyojuntotratavistocrearcampohemoscincocargopisosordenhacenáreadiscopedrocercapuedapapelmenorútilclarojorgecalleponertardenadiemarcasigueellassiglocochemotosmadreclaserestoniñoquedapasarbancohijosviajepabloéstevienereinodejarfondocanalnorteletracausatomarmanoslunesautosvillavendopesartipostengamarcollevapadreunidovamoszonasambosbandamariaabusomuchasubirriojavivirgradochicaallíjovendichaestantalessalirsuelopesosfinesllamabuscoéstalleganegroplazahumorpagarjuntadobleislasbolsabañohablaluchaÁreadicenjugarnotasvalleallácargadolorabajoestégustomentemariofirmacostofichaplatahogarartesleyesaquelmuseobasespocosmitadcielochicomiedoganarsantoetapadebesplayaredessietecortecoreadudasdeseoviejodeseaaguas"domaincommonstatuseventsmastersystemactionbannerremovescrollupdateglobalmediumfilternumberchangeresultpublicscreenchoosenormaltravelissuessourcetargetspringmodulemobileswitchphotosborderregionitselfsocialactivecolumnrecordfollowtitle>eitherlengthfamilyfriendlayoutauthorcreatereviewsummerserverplayedplayerexpandpolicyformatdoublepointsseriespersonlivingdesignmonthsforcesuniqueweightpeopleenergynaturesearchfigurehavingcustomoffsetletterwindowsubmitrendergroupsuploadhealthmethodvideosschoolfutureshadowdebatevaluesObjectothersrightsleaguechromesimplenoticesharedendingseasonreportonlinesquarebuttonimagesenablemovinglatestwinterFranceperiodstrongrepeatLondondetailformeddemandsecurepassedtoggleplacesdevicestaticcitiesstreamyellowattackstreetflighthiddeninfo">openedusefulvalleycausesleadersecretseconddamagesportsexceptratingsignedthingseffectfieldsstatesofficevisualeditorvolumeReportmuseummoviesparentaccessmostlymother" id="marketgroundchancesurveybeforesymbolmomentspeechmotioninsidematterCenterobjectexistsmiddleEuropegrowthlegacymannerenoughcareeransweroriginportalclientselectrandomclosedtopicscomingfatheroptionsimplyraisedescapechosenchurchdefinereasoncorneroutputmemoryiframepolicemodelsNumberduringoffersstyleskilledlistedcalledsilvermargindeletebetterbrowselimitsGlobalsinglewidgetcenterbudgetnowrapcreditclaimsenginesafetychoicespirit-stylespreadmakingneededrussiapleaseextentScriptbrokenallowschargedividefactormember-basedtheoryconfigaroundworkedhelpedChurchimpactshouldalwayslogo" bottomlist">){var prefixorangeHeader.push(couplegardenbridgelaunchReviewtakingvisionlittledatingButtonbeautythemesforgotSearchanchoralmostloadedChangereturnstringreloadMobileincomesupplySourceordersviewed courseAbout islandPhilipawardshandleimportOfficeregardskillsnationSportsdegreeweekly (e.g.behinddoctorloggedunitedbeyond-scaleacceptservedmarineFootercamera ++_form"leavesstress" /> ++.gif" onloadloaderOxfordsistersurvivlistenfemaleDesignsize="appealtext">levelsthankshigherforcedanimalanyoneAfricaagreedrecentPeople
wonderpricesturned|| {};main">inlinesundaywrap">failedcensusminutebeaconquotes150px|estateremoteemail"linkedright;signalformal1.htmlsignupprincefloat:.png" forum.AccesspaperssoundsextendHeightsliderUTF-8"& Before. WithstudioownersmanageprofitjQueryannualparamsboughtfamousgooglelongeri++) {israelsayingdecidehome">headerensurebranchpiecesblock;statedtop">boston.test(avatartested_countforumsschemaindex,filledsharesreaderalert(appearSubmitline">body"> ++* TheThoughseeingjerseyNews ++System DavidcancertablesprovedApril reallydriveritem">more">boardscolorscampusfirst || [];media.guitarfinishwidth:showedOther .php" assumelayerswilsonstoresreliefswedenCustomeasily your String ++ ++Whiltaylorclear:resortfrenchthough") + "buyingbrandsMembername">oppingsector5px;">vspacepostermajor coffeemartinmaturehappenkansaslink">Images=falsewhile hspace0& ++ ++In powerPolski-colorjordanBottomStart -count2.htmlnews">01.jpgOnline-rightmillerseniorISBN 00,000 guidesvalue)ectionrepair.xml" rights.html-blockregExp:hoverwithinvirginphones using ++ var >'); ++ ++ ++bahasabrasilgalegomagyarpolskisrpskiردو中文简体繁體信息中国我们一个公司管理论坛可以服务时间个人产品自己企业查看工作联系没有网站所有评论中心文章用户首页作者技术问题相关下载搜索使用软件在线主题资料视频回复注册网络收藏内容推荐市场消息空间发布什么好友生活图片发展如果手机新闻最新方式北京提供关于更多这个系统知道游戏广告其他发表安全第一会员进行点击版权电子世界设计免费教育加入活动他们商品博客现在上海如何已经留言详细社区登录本站需要价格支持国际链接国家建设朋友阅读法律位置经济选择这样当前分类排行因为交易最后音乐不能通过行业科技可能设备合作大家社会研究专业全部项目这里还是开始情况电脑文件品牌帮助文化资源大学学习地址浏览投资工程要求怎么时候功能主要目前资讯城市方法电影招聘声明任何健康数据美国汽车介绍但是交流生产所以电话显示一些单位人员分析地图旅游工具学生系列网友帖子密码频道控制地区基本全国网上重要第二喜欢进入友情这些考试发现培训以上政府成为环境香港同时娱乐发送一定开发作品标准欢迎解决地方一下以及责任或者客户代表积分女人数码销售出现离线应用列表不同编辑统计查询不要有关机构很多播放组织政策直接能力来源時間看到热门关键专区非常英语百度希望美女比较知识规定建议部门意见精彩日本提高发言方面基金处理权限影片银行还有分享物品经营添加专家这种话题起来业务公告记录简介质量男人影响引用报告部分快速咨询时尚注意申请学校应该历史只是返回购买名称为了成功说明供应孩子专题程序一般會員只有其它保护而且今天窗口动态状态特别认为必须更新小说我們作为媒体包括那么一样国内是否根据电视学院具有过程由于人才出来不过正在明星故事关系标题商务输入一直基础教学了解建筑结果全球通知计划对于艺术相册发生真的建立等级类型经验实现制作来自标签以下原创无法其中個人一切指南关闭集团第三关注因此照片深圳商业广州日期高级最近综合表示专辑行为交通评价觉得精华家庭完成感觉安装得到邮件制度食品虽然转载报价记者方案行政人民用品东西提出酒店然后付款热点以前完全发帖设置领导工业医院看看经典原因平台各种增加材料新增之后职业效果今年论文我国告诉版主修改参与打印快乐机械观点存在精神获得利用继续你们这么模式语言能够雅虎操作风格一起科学体育短信条件治疗运动产业会议导航先生联盟可是問題结构作用调查資料自动负责农业访问实施接受讨论那个反馈加强女性范围服務休闲今日客服觀看参加的话一点保证图书有效测试移动才能决定股票不断需求不得办法之间采用营销投诉目标爱情摄影有些複製文学机会数字装修购物农村全面精品其实事情水平提示上市谢谢普通教师上传类别歌曲拥有创新配件只要时代資訊达到人生订阅老师展示心理贴子網站主題自然级别简单改革那些来说打开代码删除证券节目重点次數多少规划资金找到以后大全主页最佳回答天下保障现代检查投票小时沒有正常甚至代理目录公开复制金融幸福版本形成准备行情回到思想怎样协议认证最好产生按照服装广东动漫采购新手组图面板参考政治容易天地努力人们升级速度人物调整流行造成文字韩国贸易开展相關表现影视如此美容大小报道条款心情许多法规家居书店连接立即举报技巧奥运登入以来理论事件自由中华办公妈妈真正不错全文合同价值别人监督具体世纪团队创业承担增长有人保持商家维修台湾左右股份答案实际电信经理生命宣传任务正式特色下来协会只能当然重新內容指导运行日志賣家超过土地浙江支付推出站长杭州执行制造之一推广现场描述变化传统歌手保险课程医疗经过过去之前收入年度杂志美丽最高登陆未来加工免责教程版块身体重庆出售成本形式土豆出價东方邮箱南京求职取得职位相信页面分钟网页确定图例网址积极错误目的宝贝机关风险授权病毒宠物除了評論疾病及时求购站点儿童每天中央认识每个天津字体台灣维护本页个性官方常见相机战略应当律师方便校园股市房屋栏目员工导致突然道具本网结合档案劳动另外美元引起改变第四会计說明隐私宝宝规范消费共同忘记体系带来名字發表开放加盟受到二手大量成人数量共享区域女孩原则所在结束通信超级配置当时优秀性感房产遊戲出口提交就业保健程度参数事业整个山东情感特殊分類搜尋属于门户财务声音及其财经坚持干部成立利益考虑成都包装用戶比赛文明招商完整真是眼睛伙伴威望领域卫生优惠論壇公共良好充分符合附件特点不可英文资产根本明显密碼公众民族更加享受同学启动适合原来问答本文美食绿色稳定终于生物供求搜狐力量严重永远写真有限竞争对象费用不好绝对十分促进点评影音优势不少欣赏并且有点方向全新信用设施形象资格突破随着重大于是毕业智能化工完美商城统一出版打造產品概况用于保留因素中國存储贴图最愛长期口价理财基地安排武汉里面创建天空首先完善驱动下面不再诚信意义阳光英国漂亮军事玩家群众农民即可名稱家具动画想到注明小学性能考研硬件观看清楚搞笑首頁黄金适用江苏真实主管阶段註冊翻译权利做好似乎通讯施工狀態也许环保培养概念大型机票理解匿名cuandoenviarmadridbuscariniciotiempoporquecuentaestadopuedenjuegoscontraestánnombretienenperfilmaneraamigosciudadcentroaunquepuedesdentroprimerpreciosegúnbuenosvolverpuntossemanahabíaagostonuevosunidoscarlosequiponiñosmuchosalgunacorreoimagenpartirarribamaríahombreempleoverdadcambiomuchasfueronpasadolíneaparecenuevascursosestabaquierolibroscuantoaccesomiguelvarioscuatrotienesgruposseráneuropamediosfrenteacercademásofertacochesmodeloitalialetrasalgúncompracualesexistecuerposiendoprensallegarviajesdineromurciapodrápuestodiariopuebloquieremanuelpropiocrisisciertoseguromuertefuentecerrargrandeefectopartesmedidapropiaofrecetierrae-mailvariasformasfuturoobjetoseguirriesgonormasmismosúnicocaminositiosrazóndebidopruebatoledoteníajesúsesperococinaorigentiendacientocádizhablarseríalatinafuerzaestiloguerraentraréxitolópezagendavídeoevitarpaginametrosjavierpadresfácilcabezaáreassalidaenvíojapónabusosbienestextosllevarpuedanfuertecomúnclaseshumanotenidobilbaounidadestáseditarcreadoдлячтокакилиэтовсеегопритакещеужеКакбезбылониВсеподЭтотомчемнетлетразонагдемнеДляПринаснихтемктогодвоттамСШАмаяЧтовасвамемуТакдванамэтиэтуВамтехпротутнаддняВоттринейВаснимсамтотрубОнимирнееОООлицэтаОнанемдоммойдвеоносудकेहैकीसेकाकोऔरपरनेएककिभीइसकरतोहोआपहीयहयातकथाjagranआजजोअबदोगईजागएहमइनवहयेथेथीघरजबदीकईजीवेनईनएहरउसमेकमवोलेसबमईदेओरआमबसभरबनचलमनआगसीलीعلىإلىهذاآخرعددالىهذهصورغيركانولابينعرضذلكهنايومقالعليانالكنحتىقبلوحةاخرفقطعبدركنإذاكمااحدإلافيهبعضكيفبحثومنوهوأناجدالهاسلمعندليسعبرصلىمنذبهاأنهمثلكنتالاحيثمصرشرححولوفياذالكلمرةانتالفأبوخاصأنتانهاليعضووقدابنخيربنتلكمشاءوهيابوقصصومارقمأحدنحنعدمرأياحةكتبدونيجبمنهتحتجهةسنةيتمكرةغزةنفسبيتللهلناتلكقلبلماعنهأولشيءنورأمافيكبكلذاترتببأنهمسانكبيعفقدحسنلهمشعرأهلشهرقطرطلبprofileservicedefaulthimselfdetailscontentsupportstartedmessagesuccessfashioncountryaccountcreatedstoriesresultsrunningprocesswritingobjectsvisiblewelcomearticleunknownnetworkcompanydynamicbrowserprivacyproblemServicerespectdisplayrequestreservewebsitehistoryfriendsoptionsworkingversionmillionchannelwindow.addressvisitedweathercorrectproductedirectforwardyou canremovedsubjectcontrolarchivecurrentreadinglibrarylimitedmanagerfurthersummarymachineminutesprivatecontextprogramsocietynumberswrittenenabledtriggersourcesloadingelementpartnerfinallyperfectmeaningsystemskeepingculture",journalprojectsurfaces"expiresreviewsbalanceEnglishContentthroughPlease opinioncontactaverageprimaryvillageSpanishgallerydeclinemeetingmissionpopularqualitymeasuregeneralspeciessessionsectionwriterscounterinitialreportsfiguresmembersholdingdisputeearlierexpressdigitalpictureAnothermarriedtrafficleadingchangedcentralvictoryimages/reasonsstudiesfeaturelistingmust beschoolsVersionusuallyepisodeplayinggrowingobviousoverlaypresentactions</ul> ++wrapperalreadycertainrealitystorageanotherdesktopofferedpatternunusualDigitalcapitalWebsitefailureconnectreducedAndroiddecadesregular & animalsreleaseAutomatgettingmethodsnothingPopularcaptionletterscapturesciencelicensechangesEngland=1&History = new CentralupdatedSpecialNetworkrequirecommentwarningCollegetoolbarremainsbecauseelectedDeutschfinanceworkersquicklybetweenexactlysettingdiseaseSocietyweaponsexhibit<!--Controlclassescoveredoutlineattacksdevices(windowpurposetitle="Mobile killingshowingItaliandroppedheavilyeffects-1']); ++confirmCurrentadvancesharingopeningdrawingbillionorderedGermanyrelated</form>includewhetherdefinedSciencecatalogArticlebuttonslargestuniformjourneysidebarChicagoholidayGeneralpassage,"animatefeelingarrivedpassingnaturalroughly. ++ ++The but notdensityBritainChineselack oftributeIreland" data-factorsreceivethat isLibraryhusbandin factaffairsCharlesradicalbroughtfindinglanding:lang="return leadersplannedpremiumpackageAmericaEdition]"Messageneed tovalue="complexlookingstationbelievesmaller-mobilerecordswant tokind ofFirefoxyou aresimilarstudiedmaximumheadingrapidlyclimatekingdomemergedamountsfoundedpioneerformuladynastyhow to SupportrevenueeconomyResultsbrothersoldierlargelycalling."AccountEdward segmentRobert effortsPacificlearnedup withheight:we haveAngelesnations_searchappliedacquiremassivegranted: falsetreatedbiggestbenefitdrivingStudiesminimumperhapsmorningsellingis usedreversevariant role="missingachievepromotestudentsomeoneextremerestorebottom:evolvedall thesitemapenglishway to AugustsymbolsCompanymattersmusicalagainstserving})(); ++paymenttroubleconceptcompareparentsplayersregionsmonitor ''The winningexploreadaptedGalleryproduceabilityenhancecareers). The collectSearch ancientexistedfooter handlerprintedconsoleEasternexportswindowsChannelillegalneutralsuggest_headersigning.html">settledwesterncausing-webkitclaimedJusticechaptervictimsThomas mozillapromisepartieseditionoutside:false,hundredOlympic_buttonauthorsreachedchronicdemandssecondsprotectadoptedprepareneithergreatlygreateroverallimprovecommandspecialsearch.worshipfundingthoughthighestinsteadutilityquarterCulturetestingclearlyexposedBrowserliberal} catchProjectexamplehide();FloridaanswersallowedEmperordefenseseriousfreedomSeveral-buttonFurtherout of != nulltrainedDenmarkvoid(0)/all.jspreventRequestStephen ++ ++When observe</h2> ++Modern provide" alt="borders. ++ ++For ++ ++Many artistspoweredperformfictiontype ofmedicalticketsopposedCouncilwitnessjusticeGeorge Belgium...</a>twitternotablywaitingwarfare Other rankingphrasesmentionsurvivescholar</p> ++ Countryignoredloss ofjust asGeorgiastrange<head><stopped1']); ++islandsnotableborder:list ofcarried100,000</h3> ++ severalbecomesselect wedding00.htmlmonarchoff theteacherhighly biologylife ofor evenrise of»plusonehunting(thoughDouglasjoiningcirclesFor theAncientVietnamvehiclesuch ascrystalvalue =Windowsenjoyeda smallassumed<a id="foreign All rihow theDisplayretiredhoweverhidden;battlesseekingcabinetwas notlook atconductget theJanuaryhappensturninga:hoverOnline French lackingtypicalextractenemieseven ifgeneratdecidedare not/searchbeliefs-image:locatedstatic.login">convertviolententeredfirst">circuitFinlandchemistshe was10px;">as suchdivided</span>will beline ofa greatmystery/index.fallingdue to railwaycollegemonsterdescentit withnuclearJewish protestBritishflowerspredictreformsbutton who waslectureinstantsuicidegenericperiodsmarketsSocial fishingcombinegraphicwinners<br /><by the NaturalPrivacycookiesoutcomeresolveSwedishbrieflyPersianso muchCenturydepictscolumnshousingscriptsnext tobearingmappingrevisedjQuery(-width:title">tooltipSectiondesignsTurkishyounger.match(})(); ++ ++burningoperatedegreessource=Richardcloselyplasticentries</tr> ++color:#ul id="possessrollingphysicsfailingexecutecontestlink toDefault<br /> ++: true,chartertourismclassicproceedexplain</h1> ++online.?xml vehelpingdiamonduse theairlineend -->).attr(readershosting#ffffffrealizeVincentsignals src="/ProductdespitediversetellingPublic held inJoseph theatreaffects<style>a largedoesn'tlater, ElementfaviconcreatorHungaryAirportsee theso thatMichaelSystemsPrograms, and width=e"tradingleft"> ++personsGolden Affairsgrammarformingdestroyidea ofcase ofoldest this is.src = cartoonregistrCommonsMuslimsWhat isin manymarkingrevealsIndeed,equally/show_aoutdoorescape(Austriageneticsystem,In the sittingHe alsoIslandsAcademy ++ <!--Daniel bindingblock">imposedutilizeAbraham(except{width:putting).html(|| []; ++DATA[ *kitchenmountedactual dialectmainly _blank'installexpertsif(typeIt also© ">Termsborn inOptionseasterntalkingconcerngained ongoingjustifycriticsfactoryits ownassaultinvitedlastinghis ownhref="/" rel="developconcertdiagramdollarsclusterphp?id=alcohol);})();using a><span>vesselsrevivalAddressamateurandroidallegedillnesswalkingcentersqualifymatchesunifiedextinctDefensedied in ++ <!-- customslinkingLittle Book ofeveningmin.js?are thekontakttoday's.html" target=wearingAll Rig; ++})();raising Also, crucialabout">declare--> ++<scfirefoxas muchappliesindex, s, but type = ++ ++<!--towardsRecordsPrivateForeignPremierchoicesVirtualreturnsCommentPoweredinline;povertychamberLiving volumesAnthonylogin" RelatedEconomyreachescuttinggravitylife inChapter-shadowNotable</td> ++ returnstadiumwidgetsvaryingtravelsheld bywho arework infacultyangularwho hadairporttown of ++ ++Some 'click'chargeskeywordit willcity of(this);Andrew unique checkedor more300px; return;rsion="pluginswithin herselfStationFederalventurepublishsent totensionactresscome tofingersDuke ofpeople,exploitwhat isharmonya major":"httpin his menu"> ++monthlyofficercouncilgainingeven inSummarydate ofloyaltyfitnessand wasemperorsupremeSecond hearingRussianlongestAlbertalateralset of small">.appenddo withfederalbank ofbeneathDespiteCapitalgrounds), and percentit fromclosingcontainInsteadfifteenas well.yahoo.respondfighterobscurereflectorganic= Math.editingonline paddinga wholeonerroryear ofend of barrierwhen itheader home ofresumedrenamedstrong>heatingretainscloudfrway of March 1knowingin partBetweenlessonsclosestvirtuallinks">crossedEND -->famous awardedLicenseHealth fairly wealthyminimalAfricancompetelabel">singingfarmersBrasil)discussreplaceGregoryfont copursuedappearsmake uproundedboth ofblockedsaw theofficescoloursif(docuwhen heenforcepush(fuAugust UTF-8">Fantasyin mostinjuredUsuallyfarmingclosureobject defenceuse of Medical<body> ++evidentbe usedkeyCodesixteenIslamic#000000entire widely active (typeofone cancolor =speakerextendsPhysicsterrain<tbody>funeralviewingmiddle cricketprophetshifteddoctorsRussell targetcompactalgebrasocial-bulk ofman and</td> ++ he left).val()false);logicalbankinghome tonaming Arizonacredits); ++}); ++founderin turnCollinsbefore But thechargedTitle">CaptainspelledgoddessTag -->Adding:but wasRecent patientback in=false&Lincolnwe knowCounterJudaismscript altered']); ++ has theunclearEvent',both innot all ++ ++<!-- placinghard to centersort ofclientsstreetsBernardassertstend tofantasydown inharbourFreedomjewelry/about..searchlegendsis mademodern only ononly toimage" linear painterand notrarely acronymdelivershorter00&as manywidth="/* <![Ctitle =of the lowest picked escapeduses ofpeoples PublicMatthewtacticsdamagedway forlaws ofeasy to windowstrong simple}catch(seventhinfoboxwent topaintedcitizenI don'tretreat. Some ww."); ++bombingmailto:made in. Many carries||{};wiwork ofsynonymdefeatsfavoredopticalpageTraunless sendingleft"><comScorAll thejQuery.touristClassicfalse" Wilhelmsuburbsgenuinebishops.split(global followsbody ofnominalContactsecularleft tochiefly-hidden-banner</li> ++ ++. When in bothdismissExplorealways via thespañolwelfareruling arrangecaptainhis sonrule ofhe tookitself,=0&(calledsamplesto makecom/pagMartin Kennedyacceptsfull ofhandledBesides//--></able totargetsessencehim to its by common.mineralto takeways tos.org/ladvisedpenaltysimple:if theyLettersa shortHerbertstrikes groups.lengthflightsoverlapslowly lesser social </p> ++ it intoranked rate oful> ++ attemptpair ofmake itKontaktAntoniohaving ratings activestreamstrapped").css(hostilelead tolittle groups,Picture--> ++ ++ rows=" objectinverse<footerCustomV><\/scrsolvingChamberslaverywoundedwhereas!= 'undfor allpartly -right:Arabianbacked centuryunit ofmobile-Europe,is homerisk ofdesiredClintoncost ofage of become none ofp"Middle ead')[0Criticsstudios>©group">assemblmaking pressedwidget.ps:" ? rebuiltby someFormer editorsdelayedCanonichad thepushingclass="but arepartialBabylonbottom carrierCommandits useAs withcoursesa thirddenotesalso inHouston20px;">accuseddouble goal ofFamous ).bind(priests Onlinein Julyst + "gconsultdecimalhelpfulrevivedis veryr'+'iptlosing femalesis alsostringsdays ofarrivalfuture <objectforcingString(" /> ++ here isencoded. The balloondone by/commonbgcolorlaw of Indianaavoidedbut the2px 3pxjquery.after apolicy.men andfooter-= true;for usescreen.Indian image =family,http://  driverseternalsame asnoticedviewers})(); ++ is moreseasonsformer the newis justconsent Searchwas thewhy theshippedbr><br>width: height=made ofcuisineis thata very Admiral fixed;normal MissionPress, ontariocharsettry to invaded="true"spacingis mosta more totallyfall of}); ++ immensetime inset outsatisfyto finddown tolot of Playersin Junequantumnot thetime todistantFinnishsrc = (single help ofGerman law andlabeledforestscookingspace">header-well asStanleybridges/globalCroatia About [0]; ++ it, andgroupedbeing a){throwhe madelighterethicalFFFFFF"bottom"like a employslive inas seenprintermost ofub-linkrejectsand useimage">succeedfeedingNuclearinformato helpWomen'sNeitherMexicanprotein<table by manyhealthylawsuitdevised.push({sellerssimply Through.cookie Image(older">us.js"> Since universlarger open to!-- endlies in']); ++ marketwho is ("DOMComanagedone fortypeof Kingdomprofitsproposeto showcenter;made itdressedwere inmixtureprecisearisingsrc = 'make a securedBaptistvoting ++ var March 2grew upClimate.removeskilledway the</head>face ofacting right">to workreduceshas haderectedshow();action=book ofan area== "htt<header ++<html>conformfacing cookie.rely onhosted .customhe wentbut forspread Family a meansout theforums.footage">MobilClements" id="as highintense--><!--female is seenimpliedset thea stateand hisfastestbesidesbutton_bounded"><img Infoboxevents,a youngand areNative cheaperTimeoutand hasengineswon the(mostlyright: find a -bottomPrince area ofmore ofsearch_nature,legallyperiod,land ofor withinducedprovingmissilelocallyAgainstthe wayk"px;"> ++pushed abandonnumeralCertainIn thismore inor somename isand, incrownedISBN 0-createsOctobermay notcenter late inDefenceenactedwish tobroadlycoolingonload=it. TherecoverMembersheight assumes<html> ++people.in one =windowfooter_a good reklamaothers,to this_cookiepanel">London,definescrushedbaptismcoastalstatus title" move tolost inbetter impliesrivalryservers SystemPerhapses and contendflowinglasted rise inGenesisview ofrising seem tobut in backinghe willgiven agiving cities.flow of Later all butHighwayonly bysign ofhe doesdiffersbattery&lasinglesthreatsintegertake onrefusedcalled =US&See thenativesby thissystem.head of:hover,lesbiansurnameand allcommon/header__paramsHarvard/pixel.removalso longrole ofjointlyskyscraUnicodebr /> ++AtlantanucleusCounty,purely count">easily build aonclicka givenpointerh"events else { ++ditionsnow the, with man whoorg/Webone andcavalryHe diedseattle00,000 {windowhave toif(windand itssolely m"renewedDetroitamongsteither them inSenatorUs</a><King ofFrancis-produche usedart andhim andused byscoringat hometo haverelatesibilityfactionBuffalolink"><what hefree toCity ofcome insectorscountedone daynervoussquare };if(goin whatimg" alis onlysearch/tuesdaylooselySolomonsexual - <a hrmedium"DO NOT France,with a war andsecond take a > ++ ++ ++market.highwaydone inctivity"last">obligedrise to"undefimade to Early praisedin its for hisathleteJupiterYahoo! termed so manyreally s. The a woman?value=direct right" bicycleacing="day andstatingRather,higher Office are nowtimes, when a pay foron this-link">;borderaround annual the Newput the.com" takin toa brief(in thegroups.; widthenzymessimple in late{returntherapya pointbanninginks"> ++();" rea place\u003Caabout atr> ++ ccount gives a<SCRIPTRailwaythemes/toolboxById("xhumans,watchesin some if (wicoming formats Under but hashanded made bythan infear ofdenoted/iframeleft involtagein eacha"base ofIn manyundergoregimesaction </p> ++<ustomVa;></importsor thatmostly &re size="</a></ha classpassiveHost = WhetherfertileVarious=[];(fucameras/></td>acts asIn some> ++ ++<!organis <br />Beijingcatalàdeutscheuropeueuskaragaeilgesvenskaespañamensajeusuariotrabajoméxicopáginasiempresistemaoctubreduranteañadirempresamomentonuestroprimeratravésgraciasnuestraprocesoestadoscalidadpersonanúmeroacuerdomúsicamiembroofertasalgunospaísesejemploderechoademásprivadoagregarenlacesposiblehotelessevillaprimeroúltimoeventosarchivoculturamujeresentradaanuncioembargomercadograndesestudiomejoresfebrerodiseñoturismocódigoportadaespaciofamiliaantoniopermiteguardaralgunaspreciosalguiensentidovisitastítuloconocersegundoconsejofranciaminutossegundatenemosefectosmálagasesiónrevistagranadacompraringresogarcíaacciónecuadorquienesinclusodeberámateriahombresmuestrapodríamañanaúltimaestamosoficialtambienningúnsaludospodemosmejorarpositionbusinesshomepagesecuritylanguagestandardcampaignfeaturescategoryexternalchildrenreservedresearchexchangefavoritetemplatemilitaryindustryservicesmaterialproductsz-index:commentssoftwarecompletecalendarplatformarticlesrequiredmovementquestionbuildingpoliticspossiblereligionphysicalfeedbackregisterpicturesdisabledprotocolaudiencesettingsactivityelementslearninganythingabstractprogressoverviewmagazineeconomictrainingpressurevarious <strong>propertyshoppingtogetheradvancedbehaviordownloadfeaturedfootballselectedLanguagedistanceremembertrackingpasswordmodifiedstudentsdirectlyfightingnortherndatabasefestivalbreakinglocationinternetdropdownpracticeevidencefunctionmarriageresponseproblemsnegativeprogramsanalysisreleasedbanner">purchasepoliciesregionalcreativeargumentbookmarkreferrerchemicaldivisioncallbackseparateprojectsconflicthardwareinterestdeliverymountainobtained= false;for(var acceptedcapacitycomputeridentityaircraftemployedproposeddomesticincludesprovidedhospitalverticalcollapseapproachpartnerslogo"><adaughterauthor" culturalfamilies/images/assemblypowerfulteachingfinisheddistrictcriticalcgi-bin/purposesrequireselectionbecomingprovidesacademicexerciseactuallymedicineconstantaccidentMagazinedocumentstartingbottom">observed: "extendedpreviousSoftwarecustomerdecisionstrengthdetailedslightlyplanningtextareacurrencyeveryonestraighttransferpositiveproducedheritageshippingabsolutereceivedrelevantbutton" violenceanywherebenefitslaunchedrecentlyalliancefollowedmultiplebulletinincludedoccurredinternal$(this).republic><tr><tdcongressrecordedultimatesolution<ul id="discoverHome</a>websitesnetworksalthoughentirelymemorialmessagescontinueactive">somewhatvictoriaWestern title="LocationcontractvisitorsDownloadwithout right"> ++measureswidth = variableinvolvedvirginianormallyhappenedaccountsstandingnationalRegisterpreparedcontrolsaccuratebirthdaystrategyofficialgraphicscriminalpossiblyconsumerPersonalspeakingvalidateachieved.jpg" />machines</h2> ++ keywordsfriendlybrotherscombinedoriginalcomposedexpectedadequatepakistanfollow" valuable</label>relativebringingincreasegovernorplugins/List of Header">" name=" ("graduate</head> ++commercemalaysiadirectormaintain;height:schedulechangingback to catholicpatternscolor: #greatestsuppliesreliable</ul> ++ <select citizensclothingwatching<li id="specificcarryingsentence<center>contrastthinkingcatch(e)southernMichael merchantcarouselpadding:interior.split("lizationOctober ){returnimproved--> ++ ++coveragechairman.png" />subjectsRichard whateverprobablyrecoverybaseballjudgmentconnect..css" /> websitereporteddefault"/></a> ++electricscotlandcreationquantity. ISBN 0did not instance-search-" lang="speakersComputercontainsarchivesministerreactiondiscountItalianocriteriastrongly: 'http:'script'coveringofferingappearedBritish identifyFacebooknumerousvehiclesconcernsAmericanhandlingdiv id="William provider_contentaccuracysection andersonflexibleCategorylawrence<script>layout="approved maximumheader"></table>Serviceshamiltoncurrent canadianchannels/themes//articleoptionalportugalvalue=""intervalwirelessentitledagenciesSearch" measuredthousandspending…new Date" size="pageNamemiddle" " /></a>hidden">sequencepersonaloverflowopinionsillinoislinks"> ++ <title>versionssaturdayterminalitempropengineersectionsdesignerproposal="false"Españolreleasessubmit" er"additionsymptomsorientedresourceright"><pleasurestationshistory.leaving border=contentscenter">. ++ ++Some directedsuitablebulgaria.show();designedGeneral conceptsExampleswilliamsOriginal"><span>search">operatorrequestsa "allowingDocumentrevision. ++ ++The yourselfContact michiganEnglish columbiapriorityprintingdrinkingfacilityreturnedContent officersRussian generate-8859-1"indicatefamiliar qualitymargin:0 contentviewportcontacts-title">portable.length eligibleinvolvesatlanticonload="default.suppliedpaymentsglossary ++ ++After guidance</td><tdencodingmiddle">came to displaysscottishjonathanmajoritywidgets.clinicalthailandteachers<head> ++ affectedsupportspointer;toString</small>oklahomawill be investor0" alt="holidaysResourcelicensed (which . After considervisitingexplorerprimary search" android"quickly meetingsestimate;return ;color:# height=approval, " checked.min.js"magnetic></a></hforecast. While thursdaydvertiseéhasClassevaluateorderingexistingpatients Online coloradoOptions"campbell<!-- end</span><<br /> ++_popups|sciences," quality Windows assignedheight: <b classle" value=" Companyexamples<iframe believespresentsmarshallpart of properly). ++ ++The taxonomymuch of </span> ++" data-srtuguêsscrollTo project<head> ++attorneyemphasissponsorsfancyboxworld's wildlifechecked=sessionsprogrammpx;font- Projectjournalsbelievedvacationthompsonlightingand the special border=0checking</tbody><button Completeclearfix ++<head> ++article <sectionfindingsrole in popular Octoberwebsite exposureused to changesoperatedclickingenteringcommandsinformed numbers </div>creatingonSubmitmarylandcollegesanalyticlistingscontact.loggedInadvisorysiblingscontent"s")s. This packagescheckboxsuggestspregnanttomorrowspacing=icon.pngjapanesecodebasebutton">gamblingsuch as , while </span> missourisportingtop:1px .</span>tensionswidth="2lazyloadnovemberused in height="cript"> ++ </<tr><td height:2/productcountry include footer" <!-- title"></jquery.</form> ++(简体)(繁體)hrvatskiitalianoromânătürkçeاردوtambiénnoticiasmensajespersonasderechosnacionalserviciocontactousuariosprogramagobiernoempresasanunciosvalenciacolombiadespuésdeportesproyectoproductopúbliconosotroshistoriapresentemillonesmediantepreguntaanteriorrecursosproblemasantiagonuestrosopiniónimprimirmientrasaméricavendedorsociedadrespectorealizarregistropalabrasinterésentoncesespecialmiembrosrealidadcórdobazaragozapáginassocialesbloqueargestiónalquilersistemascienciascompletoversióncompletaestudiospúblicaobjetivoalicantebuscadorcantidadentradasaccionesarchivossuperiormayoríaalemaniafunciónúltimoshaciendoaquellosediciónfernandoambientefacebooknuestrasclientesprocesosbastantepresentareportarcongresopublicarcomerciocontratojóvenesdistritotécnicaconjuntoenergíatrabajarasturiasrecienteutilizarboletínsalvadorcorrectatrabajosprimerosnegocioslibertaddetallespantallapróximoalmeríaanimalesquiénescorazónsecciónbuscandoopcionesexteriorconceptotodavíagaleríaescribirmedicinalicenciaconsultaaspectoscríticadólaresjusticiadeberánperíodonecesitamantenerpequeñorecibidatribunaltenerifecancióncanariasdescargadiversosmallorcarequieretécnicodeberíaviviendafinanzasadelantefuncionaconsejosdifícilciudadesantiguasavanzadatérminounidadessánchezcampañasoftonicrevistascontienesectoresmomentosfacultadcréditodiversassupuestofactoressegundospequeñaгодаеслиестьбылобытьэтомЕслитогоменявсехэтойдажебылигодуденьэтотбыласебяодинсебенадосайтфотонегосвоисвойигрытожевсемсвоюлишьэтихпокаднейдомамиралиботемухотядвухсетилюдиделомиретебясвоевидечегоэтимсчеттемыценысталведьтемеводытебевышенамитипатомуправлицаоднагодызнаюмогудругвсейидеткиноодноделаделесрокиюнявесьЕстьразанашиاللهالتيجميعخاصةالذيعليهجديدالآنالردتحكمصفحةكانتاللييكونشبكةفيهابناتحواءأكثرخلالالحبدليلدروساضغطتكونهناكساحةناديالطبعليكشكرايمكنمنهاشركةرئيسنشيطماذاالفنشبابتعبررحمةكافةيقولمركزكلمةأحمدقلبييعنيصورةطريقشاركجوالأخرىمعناابحثعروضبشكلمسجلبنانخالدكتابكليةبدونأيضايوجدفريقكتبتأفضلمطبخاكثرباركافضلاحلىنفسهأيامردودأنهاديناالانمعرضتعلمداخلممكن���������������������� ++  ++ ������������������������������������������������resourcescountriesquestionsequipmentcommunityavailablehighlightDTD/xhtmlmarketingknowledgesomethingcontainerdirectionsubscribeadvertisecharacter" value="</select>Australia" class="situationauthorityfollowingprimarilyoperationchallengedevelopedanonymousfunction functionscompaniesstructureagreement" title="potentialeducationargumentssecondarycopyrightlanguagesexclusivecondition</form> ++statementattentionBiography} else { ++solutionswhen the Analyticstemplatesdangeroussatellitedocumentspublisherimportantprototypeinfluence»</effectivegenerallytransformbeautifultransportorganizedpublishedprominentuntil thethumbnailNational .focus();over the migrationannouncedfooter"> ++exceptionless thanexpensiveformationframeworkterritoryndicationcurrentlyclassNamecriticismtraditionelsewhereAlexanderappointedmaterialsbroadcastmentionedaffiliate</option>treatmentdifferent/default.Presidentonclick="biographyotherwisepermanentFrançaisHollywoodexpansionstandards</style> ++reductionDecember preferredCambridgeopponentsBusiness confusion> ++<title>presentedexplaineddoes not worldwideinterfacepositionsnewspaper</table> ++mountainslike the essentialfinancialselectionaction="/abandonedEducationparseInt(stabilityunable to ++relationsNote thatefficientperformedtwo yearsSince thethereforewrapper">alternateincreasedBattle ofperceivedtrying tonecessaryportrayedelectionsElizabethdiscoveryinsurances.length;legendaryGeographycandidatecorporatesometimesservices.inheritedCommunityreligiouslocationsCommitteebuildingsthe worldno longerbeginningreferencecannot befrequencytypicallyinto the relative;recordingpresidentinitiallytechniquethe otherit can beexistenceunderlinethis timetelephoneitemscopepracticesadvantage);return For otherprovidingdemocracyboth the extensivesufferingsupportedcomputers functionpracticalsaid thatit may beEnglish ++suspectedmargin: 0spiritual ++ ++microsoftgraduallydiscussedhe becameexecutivejquery.jshouseholdconfirmedpurchasedliterallydestroyedup to thevariationremainingit is notcenturiesJapanese among thecompletedalgorithminterestsrebellionundefinedencourageresizableinvolvingsensitiveuniversalprovision(althoughfeaturingconducted), which continued-header">February numerous overflow:componentfragmentsexcellentcolspan="technicalnear the Advanced source ofexpressedHong Kong Facebookmultiple mechanismelevationoffensive ++ sponsoreddocument.or "there arethose whomovementsprocessesdifficultsubmittedrecommendconvincedpromoting" width=".replace(classicalcoalitionhis firstdecisionsassistantindicatedevolution-wrapper"enough toalong thedelivered--> ++ ++ ++
Archbishop class="nobeing usedapproachesprivilegesnoscript> ++results inmay be theEaster eggmechanismsreasonablePopulationCollectionselected">noscript> /index.phparrival of-jssdk'));managed toincompletecasualtiescompletionChristiansSeptember arithmeticproceduresmight haveProductionit appearsPhilosophyfriendshipleading togiving thetoward theguaranteeddocumentedcolor:#000video gamecommissionreflectingchange theassociatedsans-serifonkeypress; padding:He was theunderlyingtypically , and the srcElementsuccessivesince the should be networkingaccountinguse of thelower thanshows that ++ complaintscontinuousquantitiesastronomerhe did notdue to itsapplied toan averageefforts tothe futureattempt toTherefore,capabilityRepublicanwas formedElectronickilometerschallengespublishingthe formerindigenousdirectionssubsidiaryconspiracydetails ofand in theaffordablesubstancesreason forconventionitemtype="absolutelysupposedlyremained aattractivetravellingseparatelyfocuses onelementaryapplicablefound thatstylesheetmanuscriptstands for no-repeat(sometimesCommercialin Americaundertakenquarter ofan examplepersonallyindex.php? ++percentagebest-knowncreating a" dir="ltrLieutenant ++
is said tostructuralreferendummost oftena separate-> ++
implementedcan be seenthere was ademonstratecontainer">connectionsthe Britishwas written!important;px; margin-followed byability to complicatedduring the immigrationalso called

as follows:merged withthrough thecommercial pointed outopportunityview of therequirementdivision ofprogramminghe receivedsetInterval">maintainingChristopherMuch of thewritings of" height="2size of theversion of mixture of between theExamples ofeducationalcompetitive onsubmit="director ofdistinctive/DTD XHTML relating totendency toprovince ofwhich woulddespite thescientific legislature.innerHTML allegationsAgriculturewas used inapproach tointelligentyears later,sans-serifdeterminingPerformanceappearances, which is foundationsabbreviatedhigher thans from the individual composed ofsupposed toclaims thatattributionfont-size:1elements ofHistorical his brotherat the timeanniversarygoverned byrelated to ultimately innovationsit is stillcan only bedefinitionstoGMTStringA number ofimg class="Eventually,was changedoccurred inneighboringdistinguishwhen he wasintroducingterrestrialMany of theargues thatan Americanconquest ofwidespread were killedscreen and In order toexpected todescendantsare locatedlegislativegenerations backgroundmost peopleyears afterthere is nothe highestfrequently they do notargued thatshowed thatpredominanttheologicalby the timeconsideringshort-livedcan be usedvery littleone of the had alreadyinterpretedcommunicatefeatures ofgovernment,entered the" height="3Independentpopulationslarge-scale. Although used in thedestructionpossibilitystarting intwo or moreexpressionssubordinatelarger thanhistory and ++Continentaleliminatingwill not bepractice ofin front ofsite of theensure thatto create amississippipotentiallyoutstandingbetter thanwhat is nowsituated inmeta name="TraditionalsuggestionsTranslationthe form ofatmosphericideologicalenterprisescalculatingeast of theremnants ofpluginspage/index.php?remained intransformedHe was alsowas alreadystatisticalin favor ofMinistry ofmovement offormulationis required ++question ofwas electedto become abecause of some peopleinspired bysuccessful a time whenmore commonamongst thean officialwidth:100%;technology,was adoptedto keep thesettlementslive birthsindex.html"Connecticutassigned to&times;account foralign=rightthe companyalways beenreturned toinvolvementBecause thethis period" name="q" confined toa result ofvalue="" />is actuallyEnvironment ++ ++Conversely,> ++
this is notthe presentif they areand finallya matter of ++
++ ++faster thanmajority ofafter whichcomparativeto maintainimprove theawarded theer" class="frameborderrestorationin the sameanalysis oftheir firstDuring the continentalsequence offunction(){font-size: work on the ++adopted theproperty ofdirected byeffectivelywas broughtchildren ofProgramminglonger thanmanuscriptswar againstby means ofand most ofsimilar to proprietaryoriginatingprestigiousgrammaticalexperience.to make theIt was alsois found incompetitorsin the U.S.replace thebrought thecalculationfall of thethe generalpracticallyin honor ofreleased inresidentialand some ofking of thereaction to1st Earl ofculture andprincipally ++ they can beback to thesome of hisexposure toare similarform of theaddFavoritecitizenshippart in thepeople within practiceto continue&minus;approved by the first allowed theand for thefunctioningplaying thesolution toheight="0" in his bookmore than afollows thecreated thepresence in nationalistthe idea ofa characterwere forced class="btndays of thefeatured inshowing theinterest inin place ofturn of thethe head ofLord of thepoliticallyhas its ownEducationalapproval ofsome of theeach other,behavior ofand becauseand anotherappeared onrecorded inblack"may includethe world'scan lead torefers to aborder="0" government winning theresulted in while the Washington,the subjectcity in the>

++ reflect theto completebecame moreradioactiverejected bywithout anyhis father,which couldcopy of theto indicatea politicalaccounts ofconstitutesworked witherof his lifeaccompaniedclientWidthprevent theLegislativedifferentlytogether inhas severalfor anothertext of thefounded thee with the is used forchanged theusually theplace wherewhereas the> The currentthe site ofsubstantialexperience,in the Westthey shouldslovenčinacomentariosuniversidadcondicionesactividadesexperienciatecnologíaproducciónpuntuaciónaplicacióncontraseñacategoríasregistrarseprofesionaltratamientoregístratesecretaríaprincipalesprotecciónimportantesimportanciaposibilidadinteresantecrecimientonecesidadessuscribirseasociacióndisponiblesevaluaciónestudiantesresponsableresoluciónguadalajararegistradosoportunidadcomercialesfotografíaautoridadesingenieríatelevisióncompetenciaoperacionesestablecidosimplementeactualmentenavegaciónconformidadline-height:font-family:" : "http://applicationslink" href="specifically// ++/index.html"window.open( !important;application/independence//www.googleorganizationautocompleterequirementsconservative
most notably/>
notification'undefined')Furthermore,believe thatinnerHTML = prior to thedramaticallyreferring tonegotiationsheadquartersSouth AfricaunsuccessfulPennsylvaniaAs a result, ++
English (US)appendChild(transmissions. However, intelligence" tabindex="float:right;Commonwealthranging fromin which theat least onereproductionencyclopedia;font-size:1jurisdictionat that time">compensationchampionshipmedia="all" violation ofreference toreturn true;Strict//EN" transactionsinterventionverificationInformation difficultiesChampionshipcapabilities} ++ ++Christianityfor example,Professionalrestrictionssuggest thatwas released(such as theremoveClass(unemploymentthe Americanstructure of/index.html published inspan class=""> ++ ++f (document.border: 1px {font-size:1treatment of0" height="1modificationIndependencedivided intogreater thanachievementsestablishingJavaScript" neverthelesssignificanceBroadcasting> container"> ++such as the influence ofa particularsrc='http://navigation" half of the substantial  advantage ofdiscovery offundamental metropolitanthe opposite" xml:lang="deliberatelyalign=centerevolution ofpreservationimprovementsbeginning inJesus ChristPublicationsdisagreementtext-align:r, function()similaritiesbody>is currentlyalphabeticalis sometimestype="image/many of the flow:hidden;available indescribe theexistence ofall over thethe Internet